KEGG   Mus pahari (shrew mouse): 110333049
Entry
110333049         CDS       T05929                                 

Gene name
Ptpn2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X1
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110333049 (Ptpn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110333049 (Ptpn2)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110333049 (Ptpn2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    110333049 (Ptpn2)
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 Y_phosphatase3
Other DBs
NCBI-GeneID: 110333049
NCBI-ProteinID: XP_021070085
Ensembl: MGP_PahariEiJ_G0019102
LinkDB
Position
15
AA seq 406 aa
MSATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQSTENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDREMVFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGE
DVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTKGDSNIQKRWKELSKEDLSPI
CDHSQNRMMVEKYNGKRIGSEDEKLTGLPSKVQDTVEESSESILRKRIREDRKATTAQKV
QQMKQRLNETERKRKRWLYWQPILTKMGFVSVILVGALVGWTLLFQ
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcggcaaccatcgagcgggagttcgaggaactggatgctcagtgtcgctggcagccg
ttatacttggaaattcgaaatgaatctcatgactatcctcatagagtggccaagtttcca
gaaaacagaaaccgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaagtactgaaaatgattatattaatgccagcttagttgacatagaagaggcacaa
agaagttacatcttaacacagggcccccttcctaacacatgctgccatttctggctcatg
gtgtggcagcaaaagaccaaagcagttgtcatgctaaaccgaactgtagaaaaagaatcg
gttaaatgtgcacagtactggccaacggatgacagagaaatggtgtttaaggagacggga
ttcagtgtgaagctcttatctgaagatgtaaaatcatattatacagtacatctactacag
ttagaaaacatcaatagtggtgaaaccagaaccatatctcacttccattataccacctgg
ccagattttggagttccagagtcaccggcttcattcctaaacttcttgtttaaagttaga
gaatctggttccttgacccctgaccatggacctgcagtgatccattgcagtgcgggcatt
gggcgctctggcaccttctctcttgtagatacctgtctcgttctgatggaaaaaggagag
gatgttaatgtgaaacaactattactgaatatgagaaagtatcgaatgggacttattcag
acaccagaccagctcagattctcctacatggccataatagaaggagcaaagtacacaaaa
ggagattcaaatatacagaaacggtggaaagaactttctaaagaagatttatctcctatt
tgtgatcattcacaaaacagaatgatggttgagaagtacaatgggaagagaataggttca
gaagatgaaaagttaacagggcttccttctaaggtgcaggatactgtggaggagagcagt
gagagcattctacggaaacgtattcgagaggatagaaaggctacgacggctcagaaggtg
cagcagatgaaacagaggctaaatgaaactgaacgaaaaagaaaaaggtggttatattgg
caacctattctcactaagatggggtttgtgtcagtcattttggttggcgctttggttggc
tggacattgctttttcagtaa

DBGET integrated database retrieval system