KEGG   Mus pahari (shrew mouse): 110333072
Entry
110333072         CDS       T05929                                 

Gene name
Nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110333072 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110333072 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110333072 (Nr3c1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110333072 (Nr3c1)
Nuclear receptors [BR:mpah03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110333072 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 Med3 TFIIA RAB3GAP2_N Rpp20
Other DBs
NCBI-GeneID: 110333072
NCBI-ProteinID: XP_021070140
Ensembl: MGP_PahariEiJ_G0018949
LinkDB
Position
15
AA seq 793 aa
MDSKESLAPPGRDEVPSSLLGRGRGSVMDFYKTLRGGATVKVSASSPSVAAASQADSKQQ
RLLLDFSKGSASNAQQQQQQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMGND
LGYPQQGQLGLSSGETDFRLLEESIANLNRSASLPENPKSSTSAAGCAIPTEKEFPQTHS
DPSSEQQNRKSQTGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDE
NLLSPLAGEDDPFLLEGDANEDCKPLILPDTKPKIQDTGDTVLSGPSSVALPQVKTEKDD
FIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLS
QQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGTMNFPGRSVFSNGYSSPGMRPDV
SSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDC
IIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAA
LPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGF
RNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGSLLCFAPDLIINEQRMTLPCMYDQCK
HMLFISNELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKR
EGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIPKY
SNGNIKKLLFHQK
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggactccaaagaatccttagctccccctggtagagacgaagtccccagcagtttgctt
ggccgggggaggggaagcgtgatggacttttataaaaccctgaggggaggagctacagtc
aaggtttctgcttcttcaccctccgtggctgctgcttctcaggcagattccaagcagcag
aggcttctccttgatttttcaaaaggctcagcaagcaatgcacagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagccagatttatccaaagcc
gtttcactgtccatgggactgtatatgggagagaccgaaacaaaagtgatggggaatgac
ttgggctacccacagcagggccagcttggcctctcctctggggaaacagactttcggctt
ctggaagaaagcattgcaaacctcaataggtcggccagccttccagagaaccccaagagt
tcaacatctgcagctgggtgtgctatcccgacagagaaggagtttccccagactcactct
gatccatcttcagaacagcaaaatagaaaaagccagacgggcaccaacggtggcagtgtc
aagttgtataccacagaccaaagcacctttgacatcttgcaggatctggagttttctgct
gggtccccaggtaaagagacaaacgagagtccttggaggtcagacctgttgatagatgaa
aacttgctttctcctttggcgggagaagatgatccattccttctggaaggggacgcgaat
gaggattgtaagcctcttattttaccggacactaaacctaaaattcaggatactggagat
acagtcttatcaggccccagcagtgtggcgctgccccaagtgaaaacagagaaagatgat
ttcattgaactttgcacccctggggtaattaagcaagagaaactgggcccagtttattgt
caggcaagcttttctgggacaaatataattgggaataaaatgtctgccatttctgttcat
ggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatccctttct
cagcagcaggatcagaagcctgtttttaatgtcattccaccaattcccgttggttctgaa
aactggaataggtgccaaggatctggagaggacaacctgacttccctggggactatgaac
ttcccaggccgctcagtgttttctaatggatattcaagccctggaatgagaccagatgtg
agctctcctccatccagctcctccacagcaacgggaccacctcccaaactctgcctggtg
tgctccgatgaagcttcaggctgccactatggggtgctgacatgtggaagctgtaaagtc
ttctttaaaagagcagtggaaggacagcacaattacctttgtgctggaagaaatgattgc
atcattgataaaattcgaaggaaaaactgtccagcgtgccgctatcgaaaatgtcttcaa
gctggaatgaacctggaagctcgaaaaacaaagaagaaaattaaaggaattcagcaagcc
actgcaggagtctcacaagacacttctgaaaatcctaacaaaacaatagttcctgcagca
ttaccacagcttacccctaccttggtgtcactgctggaggtgattgaacctgaggtgtta
tatgcaggatatgacagctctgttccagattcagcgtggagaatcatgaccacgctcaac
atgttgggtgggcgccaagtgattgccgcagtgaaatgggcaaaggcaataccaggattc
agaaacttacacctggatgaccaaatgacccttctacagtactcatggatgtttctcatg
gcctttgccctgggctggagatcatacagacaagcaagtggaagcctgctgtgctttgcc
cctgatctgattattaatgagcagaggatgactctaccctgcatgtatgaccaatgtaaa
cacatgttgtttatctccaatgaattacaaagactgcaggtatcctacgaagagtatctc
tgtatgaaaaccttactgcttctctcctcagttcctaaggaaggtctgaagagccaagag
ttatttgatgagattcgaatgacttatatcaaagagctaggaaaagccattgtcaaaagg
gaaggaaactccagtcagaattggcagcggttttatcaactgacaaaacttttggactcc
atgcatgaggtggttgaaaatctccttacctactgcttccaaacatttttggataagacc
atgagtattgaattcccagagatgttagctgaaatcatcactaatcagataccaaaatac
tcgaatggaaatatcaagaagcttctgtttcatcaaaaatga

DBGET integrated database retrieval system