KEGG   Mus pahari (shrew mouse): 110333104
Entry
110333104         CDS       T05929                                 

Gene name
Smad7
Definition
(RefSeq) mothers against decapentaplegic homolog 7 isoform X1
  KO
K19631  mothers against decapentaplegic homolog 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110333104 (Smad7)
   04390 Hippo signaling pathway
    110333104 (Smad7)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 110333104
NCBI-ProteinID: XP_021070192
Ensembl: MGP_PahariEiJ_G0019136
LinkDB
Position
15
AA seq 424 aa
MFRTKRSALVRRLWRSRAPGGEDEEEGVGGGGGELRGEGATDGRAYGAGGGGAGRAGCCL
GKAVRGAKGHHHPHPPTSGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTR
TACLLLPGRLDCRLGPGAPASAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCES
YGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTAGCPDAVPSSAETGGTNYLA
PGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLN
SDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFP
GFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVI
FNSR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgtggggggtggcggaggcgagctgcggggagaaggggcg
acggacggccgggcttatggggctggtggcggcggtgcgggcagggctggctgctgcttg
ggcaaggcagtccgaggtgccaaaggtcaccaccatccccatcccccaacctcgggtgcc
ggggcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctcaagaaa
ctcaaggagcggcagctggagctgctgcttcaggccgtggagtcccgcggcggtacgcgc
accgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcgcccgcc
agcgcgcagcccgcgcagccgccctcgtcctactcgctccccctcctgctgtgcaaagtg
ttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgtgaatct
tacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagtcgactctgt
gaactagagtctccccctcctccttactccagatacccaatggattttctcaaaccaact
gcaggctgtccagatgctgtaccttcctccgcagaaaccggggggacgaattatctggcc
cctggggggctttcagattcccaacttcttctggagcctggggatcggtcacactggtgc
gtggtggcatactgggaggagaagactcgcgtggggaggctctactgtgtccaggagccc
tccctggatatcttctatgatctacctcaggggaatggcttttgcctcggacagctcaat
tcggacaacaagagtcagctggtacagaaggtgcggagcaagatcggctgtggcatccag
ctgactcgggaagtggatggcgtgtgggtttacaaccgcagcagttaccccatcttcatc
aagtccgccacactggacaacccggactccaggacgctgttggtgcacaaggtgttccct
ggtttctccatcaaggcttttgactatgagaaggcctacagcctacagcggcccaacgac
cacgagttcatgcagcagccatggacgggcttcaccgtgcagattagctttgtgaagggc
tggggccagtgttacacccgccagttcatcagcagctgcccgtgctggctggaggtcatc
ttcaacagccggtag

DBGET integrated database retrieval system