KEGG   Mus pahari (shrew mouse): 110333309
Entry
110333309         CDS       T05929                                 

Gene name
Fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04390  Hippo signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05200  Pathways in cancer
mpah05218  Melanoma
mpah05224  Breast cancer
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333309 (Fgf1)
   04014 Ras signaling pathway
    110333309 (Fgf1)
   04015 Rap1 signaling pathway
    110333309 (Fgf1)
   04390 Hippo signaling pathway
    110333309 (Fgf1)
   04151 PI3K-Akt signaling pathway
    110333309 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333309 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333309 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110333309 (Fgf1)
   05218 Melanoma
    110333309 (Fgf1)
   05224 Breast cancer
    110333309 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333309 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110333309 (Fgf1)
Cytokines and growth factors [BR:mpah04052]
 Growth factors
  Growth factors (RTK binding)
   110333309 (Fgf1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110333309 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110333309
NCBI-ProteinID: XP_021070552
Ensembl: MGP_PahariEiJ_G0018948
LinkDB
Position
15
AA seq 154 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSTPSEECLFLERLEENHYNTYTSKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcgcagccctgaccgagagattcaatctgcctcta
ggaaactacaaaaagcccaaactgctctactgcagcaacgggggccacttcctgaggatc
cttcctgatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgcgggcgaagtgtatataaagggtacggagaccggccagtacttg
gccatggacaccgaagggcttttatacggctcgacaccaagtgaggaatgtctgttcctg
gaaaggctggaagaaaaccattataacacttacacctccaagaagcatgcagagaagaac
tggtttgtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactatggc
caaaaagccattttgtttctgcccctcccggtgtcttctgactag

DBGET integrated database retrieval system