KEGG   Mus pahari (shrew mouse): 110333327
Entry
110333327         CDS       T05929                                 

Gene name
Csf1r
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04151  PI3K-Akt signaling pathway
mpah04380  Osteoclast differentiation
mpah04640  Hematopoietic cell lineage
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333327 (Csf1r)
   04014 Ras signaling pathway
    110333327 (Csf1r)
   04015 Rap1 signaling pathway
    110333327 (Csf1r)
   04151 PI3K-Akt signaling pathway
    110333327 (Csf1r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110333327 (Csf1r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110333327 (Csf1r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110333327 (Csf1r)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110333327 (Csf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333327 (Csf1r)
   05202 Transcriptional misregulation in cancer
    110333327 (Csf1r)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110333327 (Csf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333327 (Csf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110333327 (Csf1r)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110333327 (Csf1r)
Protein kinases [BR:mpah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110333327 (Csf1r)
CD molecules [BR:mpah04090]
 Proteins
  110333327 (Csf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set Ig_6
Other DBs
NCBI-GeneID: 110333327
NCBI-ProteinID: XP_021070575
Ensembl: MGP_PahariEiJ_G0019049
LinkDB
Position
15
AA seq 975 aa
MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCMSNGSVEWDGPISPYWTL
DPESPETILTTRNATFKNTGTYRCTELEDPMGGSTTIHLYVKDPARSWNLLAQEVTVVEG
QEAVLPCLITDPALKGSVSLVREWGRQVSRKTVYSFSPWQGFIIHKAKVLDSNTYMCKTV
VNGRESRSTGIRLKVNRVHPEPPRIKLEPSKLVRIRGEAAQIVCSATSAEVGFNVILKHG
DTKLETPLNSDFQDDSYKKVRTLSLNSVDFQDAGIYSCVASNDAGTNTATMNFQVVESAY
LNLTSEQSLLQEVSVGESLALTVHADAYPGLQHYNWTYLGPFFEDQHKFEFSTQKTIYRY
SFKLFLNRVKASEAGQYSLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSEVLFCDIS
GYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFHKVIIRSQLPIGTSKHNMT
YFCKAHNSVGNSSQYFRAFSLGRSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQ
KPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAF
GLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVI
TEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGDSSYKNIHLEKKYVRRDSGFSSQGVDT
YVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPT
FQQICFLLQEQARLERRDQDYANLPSRGSSGSESGGGSGGSSSEPEEESSSEHLACCEPG
DIAQPLLQPNNYQFC
NT seq 2928 nt   +upstreamnt  +downstreamnt
atggagttggggcctcctctggtcctgctgctggccacagtttggcatggtcagggggcc
cctgtcatcgagcctagtgggccagagctggttgtagagcctggtgaaacggtgaccctg
cgatgtatgagcaatggcagtgtggaatgggatggccccatctctccctactggaccttg
gaccccgaatctcctgaaaccatcctgaccacaagaaatgcgaccttcaaaaacactggg
acctaccgatgtaccgagcttgaagaccccatggggggcagtaccaccatccacttgtat
gtcaaagatccggcccggtcttggaatttgctggcacaggaggtgacagtggttgagggc
caggaagctgtgctgccttgtctgatcactgaccccgcactgaagggcagtgtctcactg
gtgcgtgagtggggcaggcaggtctcacgcaaaacagtctactccttctcaccgtggcaa
gggttcattatccacaaggctaaagtccttgacagcaatacctacatgtgcaagaccgtg
gtgaacggtagggaatccaggtccactggcatccggcttaaggtgaatcgagtccaccca
gagcccccacgaataaaattggagcctagcaagctggtgaggattcgaggggaggctgcc
cagatcgtgtgctcggccactagtgcggaagtcggattcaacgttatcctcaaacatgga
gacaccaagctggaaacccccctaaacagtgacttccaagatgacagttataaaaaagtc
cggaccctcagtctcaactctgtggacttccaagatgctggcatatattcctgtgtggcc
agcaatgatgctggcacaaacacggccaccatgaacttccaggtggtggagagtgcctac
ttaaacttgacctctgagcagagcctcttgcaggaggtgtctgtgggtgagagcctcgcc
ctcacggtccatgcagatgcctaccctggcctacagcattacaactggacctacctaggg
ccattctttgaagaccagcacaagtttgagtttagcactcaaaagaccatatacaggtat
tcattcaaactctttctgaaccgcgtaaaggcctcggaggcgggccagtactccttaatg
gcacaaaacaaggcaggctggaataatctgacctttgagctcaccctgcgatatccccca
gaggtcagtgttacatggatgcctgtgaatggctctgaagtcctgttctgtgacatctct
gggtaccctcagcccagcgtgacatggatggagtgcaggggccacaccgataggtgtgat
gaggcccaggccttgcaggtttggaatgacacccaccctgaagtcctgagtcagaagccc
ttccacaaagtgatcattcggagccagctgcccattgggacttcaaagcacaacatgact
tacttttgcaaagcccacaacagtgtgggtaacagctctcagtacttcagggccttctcc
ctaggacgaagcaagcagctccctgatgagtccctcttcactccggtggtggtggcctgt
atgtctgtcatgtctctgctggtgctgctgctgctgctgctcttgtacaagtacaagcag
aagccgaagtaccaggtgcgctggaagatcatcgagagctacgagggcaacagctacacc
ttcatcgaccctacccagttgccctacaatgagaagtgggagttccctcggaacaacctg
cagtttggtaagactctaggagccggtgcctttgggaaggtggtggaggctacagccttt
ggtctgggcaaagaagatgcagtgctgaaggtggctgtgaagatgctaaagtccacggct
cacgctgatgagaaggaggccctgatgtcagaactgaagatcatgagtcacctgggacag
catgagaatatagtcaacctcttgggagcctgtactcacggaggacctgtcctggtcatc
actgaatactgctgctatggggatctactcaactttctccgaaggaaggccgaggctatg
ctgggacccagcctgagtcccggtcaggaccccgagggagactccagctacaagaacatc
cacctggagaagaaatatgtgcgcagggacagtggcttctccagtcagggtgtagacacc
tacgtggagatgaggcctgtctcgacttcttcaagtgactccttctttaagcaagatctg
gacaaagaggccagccggcccctggagctctgggacctgctccacttctctagccaagtg
gctcaaggcatggccttccttgcttctaaaaactgcatccaccgggacgtcgcagctcga
aacgtgctgttgaccagcggacatgtggccaagattggggattttgggctggctagggac
atcatgaatgactccaactatgttgtcaagggcaatgcccgcctgcctgtaaagtggatg
gctccagagagcatctttgactgcgtgtacacggttcagagtgacgtgtggtcctacggc
atcctcctctgggagatcttctcgcttggtctgaacccctatcccggcatcctagtgaac
aacaagttctacaaactggtgaaggatggataccaaatggcccagcctgtatttgcaccg
aagaacatatacagcatcatgcagtcctgctgggacctggagcctaccagaagacccacc
ttccagcagatctgcttcctcctccaggaacaggcccgactggagaggagagaccaggac
tatgctaatctgccaagcagaggcagcagcggcagtgagagtggtggtggtagcggtggc
agcagcagtgagccagaagaggagagctccagtgaacacctggcctgctgtgagcccggg
gacatcgcccagcccctgctgcagcctaacaactaccagttctgctga

DBGET integrated database retrieval system