KEGG   Mus pahari (shrew mouse): 110333539
Entry
110333539         CDS       T05929                                 

Gene name
Cd14
Definition
(RefSeq) monocyte differentiation antigen CD14
  KO
K04391  monocyte differentiation antigen CD14
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04145  Phagosome
mpah04620  Toll-like receptor signaling pathway
mpah04640  Hematopoietic cell lineage
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333539 (Cd14)
   04064 NF-kappa B signaling pathway
    110333539 (Cd14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110333539 (Cd14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110333539 (Cd14)
   04620 Toll-like receptor signaling pathway
    110333539 (Cd14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110333539 (Cd14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110333539 (Cd14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110333539 (Cd14)
   05133 Pertussis
    110333539 (Cd14)
   05134 Legionellosis
    110333539 (Cd14)
   05152 Tuberculosis
    110333539 (Cd14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110333539 (Cd14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110333539 (Cd14)
   04090 CD molecules [BR:mpah04090]
    110333539 (Cd14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110333539 (Cd14)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   110333539 (Cd14)
CD molecules [BR:mpah04090]
 Proteins
  110333539 (Cd14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Receptors
  110333539 (Cd14)
SSDB
Motif
Pfam: LRR_8 LRR_4
Other DBs
NCBI-GeneID: 110333539
NCBI-ProteinID: XP_021070766
Ensembl: MGP_PahariEiJ_G0018866
LinkDB
Position
15
AA seq 367 aa
METVLGLLLLLLTLVHTSPATAEPCKLEELDEESVRCFCNFSDPQPNWSSAFQCAGAEDV
ELYGGGRSLEHFLKRVDTEADLGPFVEVIQSLLLKRLTVRAVRVPTRILFGALRVLGYSR
LQELTLENLEVTGTAPPPLLEASGPDLNILNLRNVSWATTDAWLAELQQWLKPGLKVLSI
AQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPRKFPTLQVLALRNSGMETP
SGVCSALAAARVQLQGLDLSHNSLRDAAGSPSCDWPSQLNSLNLSFTGLEQVPKGLPAKL
SVLDLSYNRLDRKPRPDELPKVGNLLLEGNPFSTSESHSGEYSCGIVTTGAPSSLAVALS
GTLALLL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagactgtgcttggcttgttgctgttgcttctgacactggtgcacacctctcctgcc
acagcagagccctgcaagctagaagagctagacgaggaaagtgtccgctgcttctgcaac
ttctcagatccgcagccaaattggtccagcgctttccagtgtgccggggcggaagatgtg
gaactctacggcggcggccgcagcctggaacactttctaaagcgtgtggacacggaagca
gatctggggccgttcgttgaagttatccagtctctgctcttaaagcggcttacggtgcga
gccgtgcgggttcctactcggattctattcggagccctgcgtgtgctcgggtattcccgc
ctccaggaactgactcttgaaaacctcgaggtaaccggcaccgcgccgccaccgcttctg
gaagcctccggaccggatctcaacatcttgaacctccgcaacgtgtcgtgggcaacaacg
gatgcctggctcgcagaactgcagcagtggctaaagcctggactcaaggtactgagtatt
gcccaagcacactcgctcaacttttcctgcgaacaggtccgcgtcttccctgccctctcc
accttagacctgtctgacaatcctgaattgggcgagagaggactgatttcggccctctgt
ccgcgcaagttcccgaccctccaagttttagcactgcgcaactcggggatggagacgccc
agcggcgtgtgctctgcgctggccgccgcaagggtgcagctgcagggactggaccttagt
cacaattcactgcgggatgctgcaggctctccgagttgtgactggcctagtcagctaaac
tccctcaatctgtctttcactgggctggagcaagtacctaaagggctgccagccaagctc
agcgtgctggatctcagttacaacaggctggataggaaacctaggccagatgagctgccc
aaagtggggaacctgttacttgaaggaaatcccttttcgacctctgaatcccactcaggg
gagtatagctgtggcatagtcaccaccggagctccttcatccctagcagtggccttgtca
ggaactctggctttgctcctatga

DBGET integrated database retrieval system