KEGG   Mus pahari (shrew mouse): 110334026
Entry
110334026         CDS       T05929                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4F isoform X1
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110334026
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mpah04054]
    110334026
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110334026
Pattern recognition receptors [BR:mpah04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110334026
SSDB
Motif
Pfam: NACHT PYRIN LRR_6 NLRC4_HD2 NOD2_WH AAA_16 NB-ARC DUF4127 AAA_30 AAA_7
Other DBs
NCBI-GeneID: 110334026
NCBI-ProteinID: XP_021071508
Ensembl: MGP_PahariEiJ_G0019716
LinkDB
Position
16
AA seq 948 aa
MASFISDFGLMWYLRELSKEEFTKFKDFLIQEILELKLKQISLTEVKKASREDLANLLLK
CGENQAWDVTFKILQKINRNDLTERVTEETADSSPLGLTDSGNPKLYRDHLKKKLTHDCS
KKFNDRIQDFIKETFIQNDYDTFENLLISKGTEKKPHMVFLKGMAGVGKTMMLKNLMLAW
SKGLVLQNKFSYTFYFCCQDVKQLKTASLAELISREWPSPSAPVEEILSQPEKLLFIIDS
LEGMEWDLTKQESELCDNCMEKQPVSTLLSSLLRRKMLPESSFLLSTTPETFEKMEDRIQ
CTDVKTATAFDERSXKIYFQRLFQDRIRAQEAFSLVRENEQLFTICQVPLLCWMVATCLK
EEIEKGRDPVSLCRXITSLYTTHIFNLFIPQSAQYPSKKSQDQLQGLCSLAAEGMWTDTF
VFGKEALRRNGILDSDIPTLLDIGMLGKISEFENSYIFLHPSVQEVCAAIFYLLKRHVDH
PSQDVKNIETVLFMFLKKVKTQWIFLGCFIFGLLQKSEQEKLLVFFGHRLSKNIQHKLYQ
CLETLSGNAELQEQIDGMKLFSCLFEMEDKAFLVKAMNCMQQINFVAKNYSDFIVAAYCL
KHCSTLNKLSFSTENVLNEEGDQRYMEELFICWKNMCSVFVRSKDIQELRIKDTNFNEPA
IRVLYESLKYPSFTLNKLVANNVSFGDNYVLFELIQNSSLQYLDLSCSFLSNSDVKLLCD
VLNQAECNIEKLMISHCKLSPDDCKIFGSILMSSKTLKVLNLASNNLNQGISSLCKALCH
PHCVLEYLVLANCSLSEQCWDYLSEVLRQNKTLSHLDISSNDLKDEGLKVLCRSLTLPYC
VLKSLCLSCCGITSRGCQDLAEVLRNNQNLKYLHVSYNKLKDTGVRLLCDAIKHPNCHLK
DLRLEACEITDASNEELCFAFIQCKTLQTLNLMGNAFEVSRMVFFPRF
NT seq 2847 nt   +upstreamnt  +downstreamnt
atggcatctttcatttcagattttggccttatgtggtacttgagagaactaagtaaggag
gaattcacgaagtttaaggactttctcatacaggagattctggaattgaagctgaaacag
atatctttgactgaagtgaagaaagcatctcgggaagatcttgccaacttacttctgaaa
tgtggggagaatcaggcctgggatgtgaccttcaaaattctccagaagatcaataggaac
gatctcactgaaagggtaacagaagagactgctgattcttcccctcttggactcactgac
tcaggaaacccaaagttatatcgagatcatttgaagaaaaaactgacccatgattgctcc
aaaaaatttaatgaccgaattcaagatttcattaaagagactttcattcagaatgactat
gacacttttgagaaccttctcatctcaaagggaactgaaaagaagccacacatggtattc
ctgaaaggcatggctggagttggcaagacaatgatgttgaaaaatttaatgctggcctgg
tcaaaaggcctggtgcttcaaaacaaattctcttacactttctacttctgctgtcaagat
gtgaagcagttgaagacagcaagccttgctgaacttatctccagagagtggcccagcccc
tcagctcctgtagaggagatcctgtcccaaccggagaaactcttatttatcattgacagc
ttggaagggatggaatgggatttaaccaaacaggaatcggagctgtgtgataactgcatg
gagaagcagccagtgagtacactgctgagcagtttgctcaggaggaagatgctccctgaa
tcctctttcctcctctccactaccccagagacttttgagaaaatggaggacaggattcag
tgcacagatgtgaaaacagcaactgcatttgatgagagaagtatnaagatatatttccag
agattgttccaagataggatcagagcccaggaggccttcagtttggtgagagaaaatgag
cagctgttcactatatgtcaagttcctctgctctgctggatggtggctacttgtctaaaa
gaggagatagagaagggaagagacccagtctccctctgccgangtatcacctccctatat
accactcacatcttcaatttgttcattccccaaagtgcccaatatccaagtaagaaaagc
caagaccagctgcagggcttatgttctctagctgctgagggcatgtggactgacacattt
gtgtttggtaaggaggctctcaggagaaatgggatcttggactctgacatccccacactt
ttggacattggaatgcttggaaagatcagcgaatttgaaaattcttacatattcctccac
ccatctgttcaggaggtctgtgctgccatcttttatctgctaaagaggcatgtggaccac
cctagccaggacgttaaaaatatagagacagtcttgtttatgtttttaaagaaagtaaaa
acacagtggatttttttgggctgtttcatctttggtcttttacagaaatcagaacaagaa
aagctactggtgttttttggccaccggttgtccaagaacatacagcataagttatatcag
tgcctggaaaccttaagtggcaatgcagagcttcaagaacaaatagatggcatgaaattg
ttttcctgtctgtttgagatggaagacaaagccttcctagtgaaagcaatgaattgtatg
caacagattaactttgtggctaagaattattctgatttcattgttgctgcctattgcttg
aaacactgttctacactgaataaattatccttttcaactgaaaatgtcctgaatgaagaa
ggagaccagaggtatatggaagagctattcatctgttggaaaaatatgtgctctgtgttt
gtaaggagtaaagacattcaggaactccgaataaaagacactaatttcaatgagccagcc
attcgagtcttgtatgaatctctgaagtaccccagcttcacccttaacaaacttgtggca
aataatgtgtcctttggtgataactacgtgctctttgagttgattcagaactccagtttg
caatacttggacctcagctgctcatttctgtccaacagtgatgtgaaactgttgtgtgat
gtcttgaaccaggcagagtgcaacatagaaaaacttatgatatcacactgtaaactttca
cctgatgactgcaagatctttggctccatcctgatgagcagcaagacgttgaaggttctt
aatttggcatccaacaatttgaaccaaggaatatcctcactgtgcaaagctttgtgccac
ccacactgcgttctggagtacttggtgttagccaactgttccctcagtgagcaatgttgg
gactacctttctgaagttcttaggcagaacaaaaccctgagccatctagatatcagctcc
aatgacctgaaggatgaaggactgaaggttctctgtaggtctctgactcttccatactgt
gtcctgaagtcactatgtttgagctgttgtggaatcacctcaaggggctgccaggacctg
gctgaagtcctgaggaacaaccagaatctgaagtacctacatgtttcatacaataagcta
aaagacactggtgtgaggctgctgtgtgatgctataaaacatcctaactgccatttaaag
gatctacggttggaagcctgtgaaataactgatgccagtaatgaggagctttgttttgct
tttatccagtgtaagaccctgcagacgctcaacctaatggggaatgccttcgaagtcagt
aggatggttttctttccaaggttctga

DBGET integrated database retrieval system