KEGG   Mus pahari (shrew mouse): 110334588
Entry
110334588         CDS       T05929                                 

Gene name
Scrib
Definition
(RefSeq) protein scribble homolog isoform X1
  KO
K16175  protein scribble
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110334588 (Scrib)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110334588 (Scrib)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110334588 (Scrib)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110334588 (Scrib)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 LRR_9 AbLIM_anchor MscS_porin
Other DBs
NCBI-GeneID: 110334588
NCBI-ProteinID: XP_021071977
Ensembl: MGP_PahariEiJ_G0019919
LinkDB
Position
17
AA seq 1665 aa
MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELG
GLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LTALPRSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQP
LPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDNLEGEEDAEEAAAEKRGLQRRATPHPSE
LKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAESALSGGSVPSASTASEGEPEILP
AEVQGPGQPEAMPVQEEYTEEDYNEPTVHFAEDTLIPREDGESEEGQPEAAWPLPSGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHAPWAPRAHEEEEE
EEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQ
TGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQDAEHH
EAVEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPVLQPETP
VPLRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDR
VLSINGVDMTEARHDHAVSLLTAASPTISLLLEREAGGPYPPSPPPHPSPTPAPTVAATV
TTAIPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDP
GVFISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPP
PPGMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVG
LRLLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAG
LGHRNSLESISSIDRELSPEGPGKEKELASQALPWEPESAETTGRNLEPLKLDYRALAAL
PSAGSLQRGPSATPGGKMSEAPCSPGSQQTKPGVIQPLAQAWPRNSPAPRGRGGPCSPPS
PDELPANVKQAYRAFAAVPTVHPPENSGTQPPTPGPAASPEQLSFRERQKYFELEVRVPQ
AEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDMGLASDRESPDDQQE
AEQPWAMPSHAGGPSPSSPPPLGGNAPVRTAKAERRHQERLRMQSPELPAPERALSPAER
RALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGLLERLAEAPSPAPTPSPTP
LEDFGLQTSASPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLEASPSPGSQ
EEDGEVALVLLGRPSPGAVGPEDMTLCSSRRAVRPGRRGLGPVPS
NT seq 4998 nt   +upstreamnt  +downstreamnt
atgctgaagtgcatcccgctctggcgttgcaaccggcacgtggagtcggtggataagcgg
cactgctcgctgcaggttgtgccagaggagatttaccgctacagtcgtagcctcgaggag
ctgctcctcgacgccaaccagctgcgcgagctacctaagcccttcttccgactattgaac
ttgcgaaagttgggcctcagtgacaacgagatccagcggctgcctcctgaagtggctaac
ttcatgcaactggtggagctggatgtgtcccggaatgatatccccgagatacctgagagc
ataaagttctgtaaggctctggagattgcagacttcagtgggaaccccctgtccaggctt
ccggatggcttcacacagctgcgcagcctggctcacctggccctgaatgacgtgtccctg
caggcactgcctggagatgtgggcaacttggccaatctggtgaccctggaactccgggag
aacctgcttaaatctctccctgcgtccctgtctttcctggtgaagctggaacagctggac
ctgggagggaatgatctggaagtgctgcctgacaccctgggggctctgcctaaccttcgg
gagctgtggctagaccgaaaccaactgtcagctctgcccccggagctaggcaatctgcgg
cggctggtgtgcctggatgtgtcagagaacaggctggaagagctgcctgtggagctgggt
gggctggcactgctcacggatctgctgctttcccagaacttgcttcagcggctgccagag
ggcattggtcagctgaagcagctgtctatcctgaaggtggaccagaaccggctgtgtgag
gtcactgaggccataggggactgtgagaacctctcggagcttatcctcacggagaacctg
ttaacggccttgccccgctccctaggcaagctgaccaagctgactaaccttaatgtggac
cggaatcatcttgaggtgctgccacctgaaatcggaggctgtgtggcccttagtgtcctc
tctctgagagacaatcgcctggccgtcctccctccggagctcgcccatacggctgagctg
cacgtgctagacgtggccgggaaccggctgcggagtctgccatttgcgctcacccacctc
aacctcaaggcactatggctggctgagaaccaggcacaacccatgctccgcttccagact
gaggatgatgcccagacgggtgaaaaggtgctcacctgctacctgctgccccagcagccc
ctgccgagtcttgaagacgctggtcagcagagcagtccctcagagagctgtagtgatgcc
cctctgagccgcgtcagtgtcatccagttcgaggacaaccttgaaggtgaagaggatgcc
gaggaagctgcggccgagaagcggggcctacagcgtagggccacacctcatcccagtgaa
ctcaaggtgatgaagaggggcattgaagagcgtcggaacgaggccttcgtctgcaagcct
gaccctagcccaccctcaccttcagaggaggagaagaggctgagtgcagagtctgccttg
agtggaggctctgtcccgtcggcaagcacagcctcggaaggtgagcctgagatcctgccg
gctgaggtgcaagggccaggccagcccgaggccatgcccgtacaggaggagtatacagaa
gaggactataatgagcccacagtgcactttgcagaggacacactgatccctagggaagac
ggtgaaagtgaagagggacagcctgaggctgcctggccgctgcccagtggccggcagagg
ctcatccgaaaagacacaccccactacaagaagcacttcaagatctccaagctcccacag
cccgaagctgttgtggccctgctgcaaggggtgcagaccgacagggagggccccactgca
ggttggcacaatggcccacacgcaccttgggctcctcgagcccatgaggaggaagaggag
gaggaggaggagaacagggatgaggaggaaggcgaggccaccacggaagaagatgacaaa
gaagaggctgtggcttctgctccctctgtcaagggggtgtcgtttgaccaggccaataac
ctgctgatagagcctgctcgcattgaggaggaagagctaacactcacgatcgtgcggcag
acagggggcctgggcatcagtatcgcaggggggaaaggctccactccctacaaaggagat
gacgagggcattttcatctctcgagtgtcggaagagggccctgcagcccgtgctggagtc
cgagttggtgacaaacttctcgaggtgaatggtgtggctttgcaggatgcagagcaccac
gaggccgtggaagcacttcggggggcaggtgctgccgtgcagatgcgagtgtggagggaa
agaatggtggagccagagaatgcagtcactattacccccttacgccctgaagatgactat
agtccccgagagtggcggggaggtggcctgcgccttcccgtgctccagcctgagactcct
gtacccctccgtcagcgccatgctgcctgcctcgtgcgcagtgaaaaggggctgggcttc
agcattgctggtggaaagggctccacaccttaccgggctggtgatgggggcatctttata
tcccgcattgcagagggaggggctgctcaccgggcaggcactctacaggttggcgaccgt
gtcctctcgatcaatggagtggacatgactgaggcacggcacgaccatgctgtctcgctg
ctgacggctgcttcccctaccatctccctgcttctggagagggaggctggagggccttac
ccacctagccctcccccccacccctccccaacccctgctcctaccgttgctgctacggtg
accactgccatccccggggagcctctgctgcctaggctgtcccctagcctcttggccacc
gccttggaaggaccataccctgtggaggaaatctgcctgcccagggctggtggcccactg
gggcttagcattgtaggaggttctgatcactccagccatccgtttggtgtccaagatcct
ggtgtgttcatctccaaggtgctccctcggggcctagctgctcgctgtggccttcgggtt
ggggaccgcatcctagcagtgaatgggcaggatgttcgggaggccacacatcaagaggca
gtcagtgccctgctcaggccctgcctggagctgtgtctgcttgtgcggagggacccacca
cccccaggcatgcgggaactctgcatccagaaggcccctggggagaagctgggtatcagc
attcgcggaggcgccaagggtcacgcggggaacccctgtgaccctacagatgagggcatc
tttatctccaaggtgagccctacaggagctgctgggcgtgatgggcggctgcgtgtgggg
ctgcggctgctagaagtgaaccaacagagcctgctgggccttacccatgcggaggcagtg
cagctgctgcgcagcgtgggcgacacccttaccgtgcttgtctgtgatggctttgacacc
agcaccaccacagccctggaggtgtccccaggtgtcattgccaacccatttgcggcaggc
cttggccacaggaacagtctggaaagcatttcgtccattgaccgggaactgagtcctgaa
ggcccaggcaaggagaaagagttggctagtcaagccctaccctgggagcctgagtctgca
gagaccacgggtcggaatctagagcccctgaagctggactaccgtgccctggccgccctg
cccagtgctgggagtttgcagagaggaccatctgcgacccctggaggcaagatgtccgag
gccccctgttcccctggcagtcagcaaacaaaaccgggggtgatccagccattggctcag
gcctggccaaggaactccccggcccccaggggcagaggtggtccctgttctccgccctcc
cctgatgaactgccagccaatgtgaagcaggcatatagggccttcgcagctgtgcccact
gtgcatcctcccgaaaacagtggtacccagcctccaacacctggtcccgcagcctcccca
gagcagctgtccttccgtgaacgacaaaagtacttcgagctggaggtgcgggtgcctcaa
gcagagggtcccccgaagcgtgtgtccctggtgggcgctgatgacttgcggaagatgcag
gaggaggaagctcgcaagctgcagcagaagagggcacagatgcttcgggaagaagcagta
acctcagggcctgacatggggctcgcctcagacagggagtccccagatgatcagcaggag
gctgagcagccctgggctatgccaagccatgccgggggccctagcccgtcatcaccccca
cccctgggaggcaacgcccctgtgaggacagccaaagctgagcgacgccatcaggaacgg
ttgcgcatgcagagccccgagcttcctgcccctgagcgggccctgtctcctgcagagcga
agggctctagaggcagagaagcgagctctgtggagggcagccagaatgaagtctctggag
caggatgccctccgtgcacagatggtccttagcaagtcccaggaaggccgtggcaagaga
ggactcttggaacggctggctgaggccccttcacctgcacctaccccgtcacccacccca
ttagaagactttggcctccagaccagtgcctcccctggacgcttgcctttgtctggaaag
aagtttgactacagggccttcgcagccctgccctcttccagacctgtgtatgacatccag
tcaccagattttgtagaagagctgaggactttggaagcgtctcccagtcctggctcccag
gaagaagacggagaagtggccctggtgctccttggcaggccctcacctggcgctgtggga
cctgaagacatgacgctgtgcagtagccgtcgggctgtgcggccgggacgccggggcctg
ggccctgtgccctcctag

DBGET integrated database retrieval system