KEGG   Mus pahari (shrew mouse): 110334656
Entry
110334656         CDS       T05929                                 

Gene name
Myc
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04110  Cell cycle
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05216  Thyroid cancer
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110334656 (Myc)
   04012 ErbB signaling pathway
    110334656 (Myc)
   04310 Wnt signaling pathway
    110334656 (Myc)
   04350 TGF-beta signaling pathway
    110334656 (Myc)
   04390 Hippo signaling pathway
    110334656 (Myc)
   04630 JAK-STAT signaling pathway
    110334656 (Myc)
   04151 PI3K-Akt signaling pathway
    110334656 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110334656 (Myc)
   04218 Cellular senescence
    110334656 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110334656 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110334656 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110334656 (Myc)
   05202 Transcriptional misregulation in cancer
    110334656 (Myc)
   05206 MicroRNAs in cancer
    110334656 (Myc)
   05205 Proteoglycans in cancer
    110334656 (Myc)
   05230 Central carbon metabolism in cancer
    110334656 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110334656 (Myc)
   05225 Hepatocellular carcinoma
    110334656 (Myc)
   05226 Gastric cancer
    110334656 (Myc)
   05216 Thyroid cancer
    110334656 (Myc)
   05221 Acute myeloid leukemia
    110334656 (Myc)
   05220 Chronic myeloid leukemia
    110334656 (Myc)
   05219 Bladder cancer
    110334656 (Myc)
   05213 Endometrial cancer
    110334656 (Myc)
   05224 Breast cancer
    110334656 (Myc)
   05222 Small cell lung cancer
    110334656 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110334656 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110334656 (Myc)
   05161 Hepatitis B
    110334656 (Myc)
   05160 Hepatitis C
    110334656 (Myc)
   05163 Human cytomegalovirus infection
    110334656 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110334656 (Myc)
   05169 Epstein-Barr virus infection
    110334656 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110334656 (Myc)
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110334656 (Myc)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    110334656 (Myc)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110334656 (Myc)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 110334656
NCBI-ProteinID: XP_021072118
Ensembl: MGP_PahariEiJ_G0019842
LinkDB
Position
17
AA seq 439 aa
MPLNVNFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
DNETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSASLSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtgaacttcgccaacaggaactatgacctcgactacgactccgtgcag
ccctatttcatctgcgacgaggaagagaatttctatcaccagcaacagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaattcgagctgcttcccaccccgccc
ctgtccccgagccgccgctccgggctctgctctccatcctatgttgcggtcgctacgtcc
ttctccccaagggaagacgatgacggcggcggtggcaacttctccaccgccgatcagctg
gagatgatgaccgagttacttggaggagacatggtgaaccagagcttcatctgtgatccc
gacaacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggtttctcg
gccgctgccaagctggtctcggagaagctggcctcctaccaggctgcgcgcaaagacagc
gccagcctgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgccgccgcgtccgagtgcattgacccctcagtggtctttccctacccgctc
aacgacagcagctcgcccaaatcctgtacctcgtccgattccacggccttctctccttcc
tcggactcgctgctgtcctccgagtcctccccacgggccagccctgagcccctagtactg
catgaggagacaccgcccaccaccagcagcgactctgaagaagaacaagaggatgaggaa
gaaattgatgtggtgtctgtggagaagaggcaaacccctgccaagaggtcggagtcgggc
tcatctccatcccgaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccactcaccagcacaactacgcagcacccccctccacgaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaagcagatcagcaacaaccgc
aaatgctccagccccaggtcctcagatacggaggaaaacgacaagaggcggacacacaac
gtcttggaacgccagaggaggaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgaattggaaaacaacgaaaaggcccccaaggtagtgatcctcaaaaaagccacc
gcctacatcctgtccattcaagcagacgagcacaagctcacctctgaaaaggacttattg
aggaaacggcgagaacagttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system