KEGG   Mus pahari (shrew mouse): 110335227Help
Entry
110335227         CDS       T05929                                 

Gene name
Ribc2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
mpah  Mus pahari (shrew mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 110335227
NCBI-ProteinID: XP_021072963
Ensembl: MGP_PahariEiJ_G0020129
LinkDB All DBs
Position
17
AA seq 377 aa AA seqDB search
MEVAMPKDLQQEANLAKKRYTDLCRQGRVFDARNRIIGGDTQAWDFQVRDQKIKEITDKA
KHEAFAAEMKHNDKVMCIAHDREQRHRKQLCRAINDFQQSFQKPETRREFDLSDPLALRK
ELPARVSDKDMRNTISGMQKFMGEDLNFQERRRFQKEQNREWFLQQHGEWEKARADHILA
EHLYTQTRLKFDETARDLLKLEDSTRKEVCAAVKAFNRNQVVELAERKRQEKQQEQEDNM
TEITNLLHGDLLSENPRQAASSFGPHRVVPDRWKGMNREQLEEIWYTQKQQIQEKLRLQE
EERQHSMDWDLRRIQKAQASLLHERQQQRLLREQRRALDCSNLHLARQQYLQKKQMDTAS
SSQPTEDYFSQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcgatgcctaaggacctacaacaggaggccaacctagccaagaagcggtac
accgatctgtgcaggcagggacgggtcttcgacgccaggaacaggatcattgggggagac
acacaagcctgggattttcaagtccgtgaccagaagataaaagaaataactgacaaagct
aagcatgaagcctttgctgctgagatgaagcacaatgacaaagtcatgtgcatagcgcat
gaccgggagcagaggcacaggaaacagctgtgtagagctatcaatgacttccagcagagc
tttcagaagccagaaactcgccgggagtttgatctttctgaccccctggccctcaggaaa
gagcttcccgcccgagtttcagacaaggacatgcggaacaccatatcaggaatgcagaag
ttcatgggagaggatttaaacttccaagagaggaggaggttccaaaaggaacagaacaga
gaatggtttctgcaacagcatggggaatgggagaaagcccgggctgaccacatactggca
gaacacctctacactcagacgagactcaagttcgatgaaacagccagagacttgctgaag
ctggaagactccaccaggaaggaagtctgcgcggccgtgaaagcgttcaacaggaaccag
gttgtggagttggcagaaagaaagaggcaagagaagcaacaagaacaagaagacaacatg
accgagatcaccaacctgctgcatggggacctgctctctgagaaccctaggcaggcggcc
agctcctttgggcctcaccgtgtggtccctgaccgctggaagggcatgaaccgagagcag
ctggaggagatctggtacacgcagaagcagcaaatccaggagaagctgaggcttcaggaa
gaagaacgccaacacagcatggactgggatctgcgcaggatccagaaggctcaggccagc
ctgctgcatgagcggcagcagcagcgcttgctgcgggaacagcgcagggccctggactgc
agcaacctccacctggccaggcagcagtacttacagaaaaaacaaatggatacagcctcc
tcaagccagcccacggaggactacttctcacagttcaatacaaggagccgctga

DBGET integrated database retrieval system