KEGG   Mus pahari (shrew mouse): 110335526
Entry
110335526         CDS       T05929                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04151  PI3K-Akt signaling pathway
mpah04211  Longevity regulating pathway
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04668  TNF signaling pathway
mpah04728  Dopaminergic synapse
mpah04911  Insulin secretion
mpah04915  Estrogen signaling pathway
mpah04918  Thyroid hormone synthesis
mpah04925  Aldosterone synthesis and secretion
mpah04926  Relaxin signaling pathway
mpah04927  Cortisol synthesis and secretion
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05020  Prion disease
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05034  Alcoholism
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110335526 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110335526 (Atf6b)
   04022 cGMP-PKG signaling pathway
    110335526 (Atf6b)
   04151 PI3K-Akt signaling pathway
    110335526 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110335526 (Atf6b)
   04915 Estrogen signaling pathway
    110335526 (Atf6b)
   04926 Relaxin signaling pathway
    110335526 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    110335526 (Atf6b)
   04918 Thyroid hormone synthesis
    110335526 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    110335526 (Atf6b)
   04925 Aldosterone synthesis and secretion
    110335526 (Atf6b)
   04927 Cortisol synthesis and secretion
    110335526 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110335526 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110335526 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    110335526 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335526 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    110335526 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    110335526 (Atf6b)
   05031 Amphetamine addiction
    110335526 (Atf6b)
   05034 Alcoholism
    110335526 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110335526 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110335526 (Atf6b)
   05161 Hepatitis B
    110335526 (Atf6b)
   05163 Human cytomegalovirus infection
    110335526 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110335526 (Atf6b)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110335526 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB Docking
Other DBs
NCBI-GeneID: 110335526
NCBI-ProteinID: XP_021073355
Ensembl: MGP_PahariEiJ_G0020466
LinkDB
Position
18
AA seq 722 aa
MDLPRPGGGGPGSRLMVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEV
AEEQAQLFRCVEQDVPFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLS
SESSHLSTEPPSQVPGVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSAPDELADI
QTKLEPASPSSSVHSEASLLSADSPSQPFIGEEVLEVKTESPSPPGCLLWDVPASSLGAV
QISMGPSPDSSSGKAPATRKPPLQPKPVVLTTVPVPPRAGPPSTAVLLQPLVQQPAVSPV
VLIQGAIRVQPEGPAPAAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQ
SRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSGLKLGSGNRKVVCIM
VFLLFIAFNFGPVSISEPPPAPISPRTSREEPRPQRHLLGFSEPGPAHGIEPLREAAQGP
EEQQPSPVGRPSFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQ
RHQRGRRKTPHRARERQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEF
LDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEE
MMQIECEVMDTRVIHIKTSTVPPSLRKQPSPSPGNTTGGPLPGSSASPAAHQASQPLYLN
HP
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggatttgccgaggcccggaggaggcgggcccgggagccggctcatggtggggggtggg
gggaagatggcggagctgatgctcctcagcgagatcgccgacccgacgcgcttcttcacc
gacaacctgctgagtccggaggactgggacagcaccttgtacagcggcctggatgaagtg
gccgaggagcaggcgcagttgttccgttgcgtggagcaggatgtcccgtttgacagcagc
tctctggatgtggggatggatgtcagcccccctgagcccccctgggaccctctacccatc
ttcccagatcttcaggtgaagtctgagccatcctcgccctgctcctcttcctccctcagc
tcagagtcctcacatctttctacagagccccccagccaggtccctggagtaggggaggtg
ctgcatgtgaagatggagtccctggcacccccactctgcctgctgggggatgacccagca
tccccctttgaaacggtccagatcactgtgggctctgcccctgatgaactcgcagatatc
cagaccaagctggaacctgcctctccatcttcttctgtccactctgaggcctccttgctg
tcagcagactctcccagtcagccttttataggagaggaggttctggaagtgaagacagag
tctccgtcccctccagggtgcctcctgtgggatgtcccagcctcttcactcggagctgtc
cagatcagcatgggtccatcccctgatagttcctcagggaaagctccggccactcggaag
cctccactgcagcccaagcctgtggtgctaaccacagttccggtgccacctagagctggg
cctcccagcaccgctgtcctcctgcaacccctagtccagcagcctgcagtgtccccagtg
gtcctcatccaaggtgctatccgagtccagcctgaagggccagctcccgcagctccacgg
cccgagaggaagagcatcgttccagcccctatgccggggaactcctgcccgcctgaggtg
gatgcaaagctgttgaagcggcagcagcggatgatcaagaaccgtgagtcggcctgccag
tcccgccgcaagaagaaagagtacctgcaaggcctggaggcccggctgcaggccgtgctg
gccgacaaccagcagctacgcagggagaacgctgccctccggcggcggctggaggccctg
ctggcggagaacagcgggctcaagctgggatccggaaacaggaaggttgtctgcatcatg
gtcttccttctcttcattgccttcaactttgggcctgtgagcatcagcgagccacctcca
gctcccatctctcctcggacgagcagggaggaaccacgaccccagaggcacctgctgggc
ttctcagagccagggccggctcatggcatcgaacccctccgggaagccgcccagggccct
gaggagcagcagcccagccctgtaggcaggcccagcttcagaaacctgacagccttcccc
gggggcgccaaggagctgctgctaagagacctggaccagctcttcctctcctctgactgc
cgccatttcaaccgaactgagtctctgaggcttgccgatgagctgagtggctgggtccaa
cgtcaccagagaggtcgacggaagacgcctcacagggcccgggagaggcagaagtcccag
ctacggaagaagtctcctccagtgaaaccagtccccacccagcctccaggaccccctgaa
agggaccccgtgggccagctgcagctctaccgccaccccggccgctcgcagccggagttt
ctagacgcaattgaccggagggaagataccttctatgttgtgtccttccgaagggaccac
ctgctgctcccagccatcagccacaacaagacatccaggcccaagatgtcgctggtgatg
ccagccatggcccccaatgagaccgtgtcgggccgggggcccccaggggactatgaggag
atgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacg
gtgcccccctctctccggaagcagccgtccccgtccccaggcaataccacaggtggcccc
ttgccaggctcctcagccagtcccgccgcccatcaggcctcccagcccctctacctcaat
cacccctga

DBGET integrated database retrieval system