KEGG   Mus pahari (shrew mouse): 110335784
Entry
110335784         CDS       T05929                                 

Gene name
Ilk
Definition
(RefSeq) integrin-linked protein kinase isoform X1
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03320  PPAR signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah05100  Bacterial invasion of epithelial cells
mpah05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110335784 (Ilk)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110335784 (Ilk)
  09158 Development and regeneration
   04360 Axon guidance
    110335784 (Ilk)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    110335784 (Ilk)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110335784 (Ilk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110335784 (Ilk)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110335784 (Ilk)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110335784 (Ilk)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: TKL group
  MLK family
   110335784 (Ilk)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110335784 (Ilk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 110335784
NCBI-ProteinID: XP_021073800
Ensembl: MGP_PahariEiJ_G0013452
LinkDB
Position
1
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggcggtgcgcttgtggctg
gacaacacagagaacgacctcaatcagggggatgatcatggcttctcccccttgcactgg
gcctgccgagaaggccgctctgcagtggttgaaatgctgatcatgcggggagcacggatc
aatgtgatgaatcgtggggatgatacacccctgcacctggcagctagtcatggacaccgt
gacattgtacagaagctgttgcaatacaaggctgacatcaatgcagtgaatgaacacggc
aatgtgccacttcactatgcatgtttctggggccaagaccaggtggcagaggacctggtg
gctaacggggctcttgtgagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcaccccttagagagcttctccgagaacgggcagagaagatgggccagaatctcaac
cgtattccatacaaggatacattctggaaggggaccactcgcacgaggccccgaaatggg
accctgaacaaacactccggtattgacttcaaacagctcaactttctggcaaagctcaac
gagaatcattctggagagctatggaaaggccgctggcaaggcaatgatattgttgtgaag
gtgctgaaggttcgagactggagtacaaggaaaagcagggacttcaatgaggaatgtccc
cggctcaggattttctcacatccaaacgtgctcccagtgctaggtgcttgccaggctccc
ccagccccccacccaaccctcatcacacactggatgccatatggatctctctacaatgtt
ctacatgaaggcaccaatttcgttgtggaccagagccaagctgtaaagtttgctttggac
atggcaagaggcatggcttttcttcacacactagagcctctcatacctcggcatgcactc
aatagccgcagtgtaatgatcgatgaagatatgactgcccgaatcagcatggctgatgtt
aagttttctttccagtgccctgggcgcatgtatgcgcctgcctgggtggcccctgaagcc
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcggtg
cttctgtgggaactggtgacacgagaggtgccctttgctgacctctctaatatggagatt
ggaatgaaggtggcactggaaggccttcggcctaccatcccaccaggtatttccccccat
gtgtgtaagctcatgaagatttgcatgaatgaagaccctgcaaagcgacccaagtttgac
atgattgtgcctatcttggagaagatgcaggacaagtag

DBGET integrated database retrieval system