KEGG   Mus pahari (shrew mouse): 110336761
Entry
110336761         CDS       T05929                                 

Gene name
Eif4ebp1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah03013  RNA transport
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04218  Cellular senescence
mpah04910  Insulin signaling pathway
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05221  Acute myeloid leukemia
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110336761 (Eif4ebp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110336761 (Eif4ebp1)
   04066 HIF-1 signaling pathway
    110336761 (Eif4ebp1)
   04151 PI3K-Akt signaling pathway
    110336761 (Eif4ebp1)
   04152 AMPK signaling pathway
    110336761 (Eif4ebp1)
   04150 mTOR signaling pathway
    110336761 (Eif4ebp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110336761 (Eif4ebp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110336761 (Eif4ebp1)
  09149 Aging
   04211 Longevity regulating pathway
    110336761 (Eif4ebp1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110336761 (Eif4ebp1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110336761 (Eif4ebp1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110336761 (Eif4ebp1)
   05163 Human cytomegalovirus infection
    110336761 (Eif4ebp1)
   05165 Human papillomavirus infection
    110336761 (Eif4ebp1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110336761 (Eif4ebp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110336761 (Eif4ebp1)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     110336761 (Eif4ebp1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 110336761
NCBI-ProteinID: XP_021075152
Ensembl: MGP_PahariEiJ_G0021418
LinkDB
Position
19
AA seq 117 aa
MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPAIPGVTSPTSDEPPTQASQSHLPSSPEDKRAGGEESQFEMDI
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtcggcgggcagcagctgcagccagactcccagccgggccatccccactcgccgcgta
gccctcggcgatggcgtgcagctcccgccnggggactacagcaccaccccgggcggcaca
ctcttcagcaccaccccgggaggaaccaggatcatctatgaccggaaattcctgatggag
tgtcggaactcacctgtggccaaaacacccccaaaggacctgccagccattcctggggtc
actagccctaccagcgatgagcctcccacgcaagccagccagagccacctgcccagcagc
ccagaagataagcgggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system