KEGG   Mus pahari (shrew mouse): 110336830
Entry
110336830         CDS       T05929                                 

Gene name
Lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04151  PI3K-Akt signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110336830 (Lpar2)
   04072 Phospholipase D signaling pathway
    110336830 (Lpar2)
   04151 PI3K-Akt signaling pathway
    110336830 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110336830 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110336830 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336830 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110336830 (Lpar2)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110336830 (Lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 zf-UBR
Other DBs
NCBI-GeneID: 110336830
NCBI-ProteinID: XP_021075240
Ensembl: MGP_PahariEiJ_G0021583
LinkDB
Position
19
AA seq 348 aa
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRSRVLTLIVGVWAAALGLGLLPAHFWHCLCDLESCSRMVP
LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR
RTFRRLLCCMCLRWSSHKSARYSASARTGASTRIMLPANGHPLMDSTL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggccagtgctactacaatgagaccatcggctttttctataataacagcggcaaggag
ctcagccttcactggcgccccaaagatgtggtggtggtggccctggggctgacagtcagt
gtgctggtgttgctgaccaatctgctggtcattgcagccatcgcctccaaccgacgcttc
caccagcccatatactacctgcttggcaacttggctgcagctgacctcttcgctggcatg
gcctacctcttcctcatgttccatactggcccacgcaccgccaggctctccatcaaaggc
tggttcctgcggcagggcctgctggacaccagcctcacggcatcggtggccacactgctg
gccatcgctgtggagcggcaccgcagtgtgatggcggtgcagctacacagccgcctgccc
cggagccgcgtgctcacactcatcgtgggtgtgtgggcggccgcgctgggtctggggttg
ctccctgcacacttctggcactgcctctgtgacttggagagttgctcacgaatggtgccc
ctgttcagccgctcctacttggcggcgtgggccctatctagcctgcttgtcttccttctc
atggtggctgtctacacgcgaattttcttctacgtgcgcagacgggtggaacgcatggcg
gagcatgtcagctgccatccccgctaccgagagacaacactcagcctggtcaagaccgtt
gtcatcattctgggggcatttgtggtgtgctggacgccgggccaggtggtactgctcctg
gatggcctggactgtaaatcctgcaacgtgctggctgtggagaagtacttcctgctcctg
gctgaggccaattcactggtcaatgcggtggtgtactcctgccgagatgccgagatgcgc
cgtaccttccgccgcctcctctgctgcatgtgtctccgctggtccagccacaagtctgcc
cgttactcggcttctgcccggacgggtgccagcacgcgaatcatgcttcctgcgaatggc
catccactaatggactccaccctttaa

DBGET integrated database retrieval system