KEGG   Mus pahari (shrew mouse): 110337225
Entry
110337225         CDS       T05929                                 

Gene name
Itgb1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04145  Phagosome
mpah04151  PI3K-Akt signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04512  ECM-receptor interaction
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05100  Bacterial invasion of epithelial cells
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05222  Small cell lung cancer
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337225 (Itgb1)
   04151 PI3K-Akt signaling pathway
    110337225 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110337225 (Itgb1)
   04514 Cell adhesion molecules
    110337225 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110337225 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110337225 (Itgb1)
   04530 Tight junction
    110337225 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110337225 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110337225 (Itgb1)
   04670 Leukocyte transendothelial migration
    110337225 (Itgb1)
  09158 Development and regeneration
   04360 Axon guidance
    110337225 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337225 (Itgb1)
   05205 Proteoglycans in cancer
    110337225 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110337225 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110337225 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110337225 (Itgb1)
   05414 Dilated cardiomyopathy
    110337225 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110337225 (Itgb1)
   05133 Pertussis
    110337225 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    110337225 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110337225 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110337225 (Itgb1)
   05140 Leishmaniasis
    110337225 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110337225 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110337225 (Itgb1)
   04515 Cell adhesion molecules [BR:mpah04515]
    110337225 (Itgb1)
   04090 CD molecules [BR:mpah04090]
    110337225 (Itgb1)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110337225 (Itgb1)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110337225 (Itgb1)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin beta subunits
   110337225 (Itgb1)
CD molecules [BR:mpah04090]
 Proteins
  110337225 (Itgb1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 110337225
NCBI-ProteinID: XP_021075657
Ensembl: MGP_PahariEiJ_G0023332
LinkDB
Position
20
AA seq 798 aa
MNFQLVFWIGLFSLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCL
ASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttccaactggttttctggattggattgttcagtttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgtggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttacaagaaggcatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccagccaagtgacata
gagaatcccagaggctcccaaactataaagaaaaataaaaatgtcaccaatcgcagcaaa
gggatggcagagaagctccggccagaagacattactcagatccaaccacaacagctgctt
ctaaaattgagatcaggagaaccacagaagtttacattaaaattcaagagggctgaagac
taccctattgatctctactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaaaagtcttgggacggatttgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggaaaaaactgtgatgccgtatattagcacaacccca
gcaaagctaagaaatccttgtacaagtgaacaaaactgcaccagcccatttagctacaaa
aatgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcaacgc
atatctggaaacttggactcaccagaaggtggttttgatgcaatcatgcaggttgcggtt
tgtggctctctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggacaa
tgtcacctggaaaataatgtatatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagttactgaagag
ttccagccggtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacattg
tctggaaactctagtaatgtgatccagcttatcatcgatgcctacaattccctttcttca
gaagtcattctggaaaatagcaaattgccagacggagtaacaataaattacaaatcctac
tgcaagaatggggtgaatgggacaggagaaaatggacgaaagtgttccaacatttccatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaataaggagtct
gaaaccattaaaattaaacctctgggcttcactgaagaagtagaggtcgttcttcagttc
atctgtaagtgcaattgccaaagccatggcatcccagcaagtcccaagtgccatgaggga
aatgggacatttgagtgtggagcctgcaggtgcaatgaggggcgtgttgggagacactgt
gaatgtagcacagatgaagtgaacagtgaagacatggacgcttactgcagaaaagagaac
agttcggaaatctgcagtaacaatggagaatgtgtctgtggacagtgtgtgtgtaggaag
agagataatacaaacgaaatttactctggcaaattctgcgagtgtgacaacttcaactgt
gataggtctaatggcttaatttgtggagggaatggtgtgtgcaggtgtcgtgtttgtgaa
tgctatcccaattacactggcagtgcatgtgactgttctttggacactggtccatgtcta
gcatcaaatggtcagatctgcaatggccggggtatttgtgaatgtggcgcatgtaagtgc
acagatcccaagtttcaagggccaacttgtgagacatgtcagacctgccttggcgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacacg
tgtgcacaggagtgctcccacttcaatctcaccaaggtagaaagcagggagaagttgccc
cagccggtacaggttgatcctgtgactcattgcaaagagaaggacattgatgactgctgg
ttctatttcacctattcagtgaatggcaacaatgaagctatcgtgcatgttgtggagact
ccagactgtcctactggtcctgacatcatcccaattgtagcaggcgtggttgctggaatt
gttcttattggtcttgccttactgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system