KEGG   Mus pahari (shrew mouse): 110337251
Entry
110337251         CDS       T05929                                 

Gene name
Smad1
Definition
(RefSeq) mothers against decapentaplegic homolog 1 isoform X1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110337251 (Smad1)
   04390 Hippo signaling pathway
    110337251 (Smad1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110337251 (Smad1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110337251 (Smad1)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 110337251
NCBI-ProteinID: XP_021075709
Ensembl: MGP_PahariEiJ_G0022855
LinkDB
Position
20
AA seq 465 aa
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ
PMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaatgtgaccagcttgttttcattcacaagtccagctgtgaagaggctccttgggtgg
aaacagggtgatgaggaagagaaatgggccgagaaagctgtggacgctttggtgaagaaa
ctgaagaagaagaaaggggccatggaagagctggagaaggccctgagctgccccggacag
ccaagtaactgcgtcaccattcctcgttccctggatggcaggttgcaggtgtcccaccgg
aagggcctgcctcacgtcatttactgtcgtgtgtggcgctggcccgacctccagagccac
catgaactgaagcctctggaatgctgtgagttcccatttggttccaagcagaaggaggtc
tgcatcaacccctaccactataagcgagtggagagcccggttctcccgccggtgctggtt
ccgaggcacagcgagtacaatcctcagcacagccttctggctcagttccgcaacctggga
caaaatgagcctcacatgccactgaacgccacgttcccagactctttccagcagcccaac
agccacccgttcccccactcccccaacagcagctaccccaactctcctggcggcagcagc
agcacctaccctcactccccgaccagctcagacccgggcagcccttttcagatgccagct
gacacacccccacctgcttacctgcctcctgaagaccccatggcccaggacggctctcag
cccatggacacgaacatgatggcgcctccactgcccgctgaaatcagcagaggagatgtt
caagcagttgcttacgaggaaccaaaacactggtgctctattgtgtactatgagctcaac
aaccgtgtgggtgaagcgttccacgcctcgtccaccagcgtgttggtggacggtttcaca
gatccgtccaacaataagaaccgcttctgccttggcttgctctccaacgttaaccggaat
tccactattgaaaacaccaggcgacatattgggaaaggagtccacctttattacgtcgga
ggagaggtgtatgcggaatgcctcagtgacagcagcatcttcgtgcagagccggaactgc
aactaccaccacggctttcatcccaccaccgtctgcaagatccccagcgggtgcagcttg
aaaatcttcaacaaccaagagtttgctcagctactggcacagtctgtgaaccacgggttc
gagacagtgtatgaactcaccaagatgtgcactattcgaatgagctttgtgaagggttgg
ggagccgaataccaccggcaggatgttactagcaccccctgctggatcgagatacatctg
catggccctctccagtggctggataaggttcttacacagatgggttcgccccacaatcct
atttcatcggtgtcttaa

DBGET integrated database retrieval system