KEGG   Mus pahari (shrew mouse): 110337432
Entry
110337432         CDS       T05929                                 

Gene name
Cdh1
Definition
(RefSeq) cadherin-1 isoform X1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
mpah05100  Bacterial invasion of epithelial cells
mpah05200  Pathways in cancer
mpah05213  Endometrial cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337432 (Cdh1)
   04390 Hippo signaling pathway
    110337432 (Cdh1)
   04371 Apelin signaling pathway
    110337432 (Cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337432 (Cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110337432 (Cdh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337432 (Cdh1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110337432 (Cdh1)
   05216 Thyroid cancer
    110337432 (Cdh1)
   05218 Melanoma
    110337432 (Cdh1)
   05219 Bladder cancer
    110337432 (Cdh1)
   05213 Endometrial cancer
    110337432 (Cdh1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110337432 (Cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110337432 (Cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110337432 (Cdh1)
   04090 CD molecules [BR:mpah04090]
    110337432 (Cdh1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110337432 (Cdh1)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110337432 (Cdh1)
CD molecules [BR:mpah04090]
 Proteins
  110337432 (Cdh1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 BACON_2
Other DBs
NCBI-GeneID: 110337432
NCBI-ProteinID: XP_021076002
Ensembl: MGP_PahariEiJ_G0023121
LinkDB
Position
20
AA seq 889 aa
MGARCRSFSALLFLLLLQVSSWLCQESKPEPEPCSPGFSSEVYTFLVPEGHLERGHVLGI
VRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLIHAWDSSHRKLSTKV
TLKSMGHHHHHRHHHHDPVSESNPELLTFPIAYSGLRRQKRDWVIPPINCPENEKGQFPK
DLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSH
AVSSNGDAVEDPMEIVITVTDQNDNRPEFIQEVFQGFVAEGALPGTSVMQVSATDADDDV
NTYNAAIAYTIISQDPELPHKNMFTVNRDTGVISVVTSGLDRESYPTYTLVVQAADLQGE
GLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNAHIVTLKVTDDDVPNTPAWNAVY
TIVNDPDQQFVVITDPNTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATV
TVDVIDVNEAPIFMPAEKRIEVPEDLGVGQEITYYTAREPDTFMNQKITYRVWRDTANWL
EINPETGAIFTRAEMDREDAEHVKNSTYIALIIATDDGSPIATGTGTLLLVLSDINDNAP
IPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQ
PRKDLEIGEYKINLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGYVEAGLQVPAILGI
LGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLH
RGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVF
DYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgggagcccggtgccgcagcttctccgcgctcctgttcctgctgctcctgcaggtctcc
tcatggctttgccaggagtcgaagccggagcctgagccctgcagccccggcttcagttct
gaggtctacaccttcctggtgccggagggacacctggagagaggccacgtcctgggcata
gtgagatttgaaggatgcaccggccgaccaaggacagccttcttctcggaagactcccga
ttcaaagtggcaacagacggtaccatcacagtcaagcggcatctgaagctccataaacta
gagaccagtttcctcatccacgcctgggactctagtcacaggaagctgtctaccaaagtg
acgctgaagtccatggggcaccaccaccaccaccggcaccaccaccacgaccccgtctct
gaatccaacccagagctgctcacctttcccatcgcctattcgggtctcagaagacagaaa
cgagactgggtcatccctcccatcaactgccctgaaaatgaaaagggccagttcccgaag
gacctggttcagatcaaatccaacagggacaaagaaacaaaggttttctacagcatcacc
ggccaaggagctgacaaaccccccgttggtgttttcatcattgagagggagacaggctgg
ctgaaagtgacgcagcctctggatagagaagccattgccaagtacatcctatattctcat
gctgtgtcttccaatggggacgcagtggaggatcccatggagatagtgatcacagtgaca
gatcagaatgacaacaggccagagtttatccaagaggtctttcagggattcgttgcagaa
ggtgctcttccaggaacctccgtgatgcaggtctcagccaccgatgcagacgatgatgtc
aacacctacaacgctgccatcgcctacaccatcatcagccaggatcctgagctgcctcac
aaaaacatgttcactgtcaacagggacaccggggtcatcagtgtggtcacctctgggctg
gaccgagagagttaccctacatacactctggtggttcaggctgctgaccttcaaggcgaa
ggcttgagtacaacagccaaggctgtgatcactgtcaaggatattaatgacaacgctccc
gtcttcaacccaagcacgtaccagggtcaagtgcctgagaatgaggtcaatgcccatatt
gtcacactcaaagtgactgacgatgacgtccccaatactccggcgtggaatgctgtgtac
accatagtcaacgatcctgaccagcagttcgttgtcatcacagaccccaacaccaatgat
ggcattttgaaaacggccaagggcttggattttgaggccaagcagcagtacatcctgcac
gtgagagtggagaacgaggagccctttgaggggtctcttgtcccttccacagccactgtc
accgtggacgtgatagatgtgaatgaagcccccatctttatgcctgcggagaagagaatc
gaagtgcctgaagaccttggtgtgggtcaggaaatcacatattataccgctcgagagccg
gacacgttcatgaatcagaagatcacgtatcgggtttggagggacactgccaactggctg
gagattaatccagagaccggtgccatttttacacgcgctgagatggacagagaagatgcg
gagcatgtgaagaacagcacgtatatagcgctcatcatcgccacggatgatggttcaccc
attgccaccggcacagggactcttctcctggtcctttcagacatcaatgacaacgctccc
atcccagagcctcgaaacatgcagttctgccagaggaacccacagccccatatcatcacc
atcttggatccagaccttccccccaacacgtcccccttcactgctgagctaacccacggg
gccagcgtcaactggaccattgagtataatgacgcagcacaagaatctctcattttgcaa
ccgagaaaagacttagagattggcgaatacaaaatcaatctcaagctcgcggataaccag
aacaaagaccaggtgaccacattggacgtccatgtgtgtgactgtgaagggacggtcaac
aactgcatgaaggcgggatacgtggaagcaggattgcaagttcctgccatccttggaatc
cttggagggattctggccctgctgattctgatcctgctgctcctactgtttctacggagg
agaacggtggtcaaagagccgctgctgccgcccgacgatgatacccgggacaatgtgtat
tactatgatgaagaagggggtggggaagaagaccaggactttgacttgagccagctgcac
aggggcttggatgcccgaccggaagtgacccgaaacgatgtggctcccaccctcatgagc
gtgccccagtatcgtccccgtcctgccaatcctgatgaaatcgggaacttcatcgatgaa
aacctgaaggcagccgacagcgaccccacggcacccccttacgactctctgttggtgttc
gactacgaggggagtggttctgaagccgctagcctgagctccctgaactcctctgagtcg
gatcaggaccaggactacgattatctgaacgagtggggcaaccgattcaagaagctggcg
gacatgtacggcggtggcgaggatgactag

DBGET integrated database retrieval system