KEGG   Mus pahari (shrew mouse): 110337888
Entry
110337888         CDS       T05929                                 

Gene name
Pdpk1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah03320  PPAR signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04510  Focal adhesion
mpah04660  T cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04910  Insulin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04931  Insulin resistance
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05145  Toxoplasmosis
mpah05205  Proteoglycans in cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05223  Non-small cell lung cancer
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110337888 (Pdpk1)
   04071 Sphingolipid signaling pathway
    110337888 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    110337888 (Pdpk1)
   04152 AMPK signaling pathway
    110337888 (Pdpk1)
   04150 mTOR signaling pathway
    110337888 (Pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110337888 (Pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    110337888 (Pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110337888 (Pdpk1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110337888 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    110337888 (Pdpk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110337888 (Pdpk1)
   03320 PPAR signaling pathway
    110337888 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    110337888 (Pdpk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110337888 (Pdpk1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110337888 (Pdpk1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110337888 (Pdpk1)
   05231 Choline metabolism in cancer
    110337888 (Pdpk1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110337888 (Pdpk1)
   05213 Endometrial cancer
    110337888 (Pdpk1)
   05223 Non-small cell lung cancer
    110337888 (Pdpk1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110337888 (Pdpk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110337888 (Pdpk1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110337888 (Pdpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110337888 (Pdpk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110337888 (Pdpk1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110337888 (Pdpk1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   110337888 (Pdpk1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    110337888 (Pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 110337888
NCBI-ProteinID: XP_021076615
Ensembl: MGP_PahariEiJ_G0023489
LinkDB
Position
21
AA seq 559 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPSSSPGIPSGGSRQGSTMDGTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVDASLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKKLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQQYQSNPDAAVQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccattcagtccagtgtggtgcta
tgttcctgcccatccccatcaatggtgaggtcccagactgagcccagctcgtcccctggc
attcctagtggtggtagcaggcagggatccaccatggatggcaccacagctgaagcccga
ccaagcaccaaccccttgcagcagcaccctgcccagctgccaccacagcctcgcaagaaa
cgccctgaagacttcaagtttgggaaaattcttggcgagggctctttttcaacagttgtt
ctggcccgagaactggccacttccagagaatatgctattaaaattctggagaaacgtcat
attataaaagaaaacaaagttccgtatgttactagagagagagatgtgatgtcgcgcctg
gatcaccccttctttgtgaaactttactttacatttcaggacgacgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacatccgcaaaattggctcattt
gatgagacctgtacccggttttacacggctgagattgtgtctgctttagaatacttgcat
ggcaagggcatcattcacagagaccttaaaccagaaaacattttgttaaatgaagacatg
cacatccagatcacagattttggaactgcaaaagtgttatccccagagagcaaacaagcc
agggccaactcatttgtaggaacagcacaatatgtttctccagaactgctcacagagaag
tcggcatgtaaaagttcagacctttgggcccttggatgtataatctatcagcttgtggca
ggactcccaccattcagagccggaaatgaatatcttatatttcagaagatcattaagctg
gaatatcatttcccagaaaaattcttccctaaggcaagagatcttgtggaaaaactcttg
gttttagatgccacaaagcgtttaggctgtgaagagatggaagggtacgggcctcttaaa
gctcatccattctttgagaccatcacttgggagaatttgcaccagcagacacctccgaag
ctcacagcttacttaccagccatgtcagaggatgatgaagactgctatggcaactacgac
aatctcctgagccagtttggcttcatgcaggtgtcatcctcctcctcttcccactccctg
tctacggtggatgccagcctgccccagaggtcgggcagcaacatagagcagtacatccat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaagttg
ttattggaaaagcaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggcccagtggataagcgaaagggtttatttgcaagacgacgacagttatta
ctcacagaagggccacatttatattatgttgatcctgtcaacaaggtcttgaaaggtgaa
atcccatggtcacaagaactccgaccagaagccaagaattttaaaactttctttgttcac
acgcctaacaggacgtactacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcagcagtaccagagcaatccagatgctgctgtgcagtga

DBGET integrated database retrieval system