KEGG   Mus pahari (shrew mouse): 110338015
Entry
110338015         CDS       T05929                                 

Gene name
Ppard
Definition
(RefSeq) peroxisome proliferator-activated receptor delta isoform X1
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03320  PPAR signaling pathway
mpah04310  Wnt signaling pathway
mpah05200  Pathways in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110338015 (Ppard)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110338015 (Ppard)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338015 (Ppard)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110338015 (Ppard)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110338015 (Ppard)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110338015 (Ppard)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110338015 (Ppard)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   110338015 (Ppard)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110338015
NCBI-ProteinID: XP_021076826
Ensembl: MGP_PahariEiJ_G0023634
LinkDB
Position
21
AA seq 440 aa
MEQPQEETPEAREEEKEEVATGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaacagccacaggaggagacccctgaggcccgggaagaggagaaagaggaagtggcc
acgggtgacggagccccagagctcaatgggggaccagagcacacacttccttccagcagc
tgtgcagacctctcccagaattcctccccttcctccctgctggaccagctgcagatgggc
tgtgatggggcctcaggcggcagcctcaacatggagtgtcgggtgtgcggggacaaggcc
tcaggcttccactacggggtccacgcgtgtgaggggtgcaagggcttcttccgacggaca
atccgcatgaagctcgagtatgagaagtgcgatcggatctgcaagatccagaagaagaac
cgcaacaagtgtcagtactgccgcttccagaagtgcctggcgctcggcatgtcgcacaat
gctatccgctttggacggatgccggaggccgagaagaggaagctggtggcggggctgacg
gccagcgaggggtgccagcacaatccccagctggccgacctgaaggccttctctaagcac
atctacaacgcctacctgaaaaacttcaacatgaccaaaaagaaggcccggagcatcctc
accggcaagtccagccacaacgcaccctttgtcatccacgacatcgagacactgtggcag
gcggagaagggcctggtgtggaaacagctggtgaacgggctgccgccctacaacgagatc
agcgtgcacgtgttctaccgctgtcagtccaccacggtggagacggtccgcgagctcacc
gagttcgccaagaacatccccaacttcagcagcctcttcctcaacgaccaggtgaccctc
ctcaagtacggcgtgcacgaggccatctttgccatgctggcctccatcgtcaacaaagat
gggctgctggtggccaacggcagtggcttcgtcacccacgagttcttgcgcagtctccgc
aagcccttcagtgacatcattgagcccaagttcgagtttgctgtcaagttcaatgcgcta
gagctcgatgacagcgacctggcgcttttcatcgcagccatcattctgtgtggagaccgg
ccaggcctcatgaatgtgccccaggtagaagccatccaggacaccattctgcgggctcta
gaattccacctgcaggtcaaccaccccgacagccagtacctcttccccaagctgctgcag
aagatggcagacctgcggcagctggtcactgagcatgcccagatgatgcagtggctaaag
aagacggagagtgagaccttgctgcaccccctgctccaggaaatctacaaggacatgtac
taa

DBGET integrated database retrieval system