KEGG   Mus pahari (shrew mouse): 110338042
Entry
110338042         CDS       T05929                                 

Gene name
Pim1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04630  JAK-STAT signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110338042 (Pim1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338042 (Pim1)
   05206 MicroRNAs in cancer
    110338042 (Pim1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110338042 (Pim1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110338042 (Pim1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110338042 (Pim1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110338042 (Pim1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   110338042 (Pim1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 110338042
NCBI-ProteinID: XP_021076883
Ensembl: MGP_PahariEiJ_G0023663
LinkDB
Position
21
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSDFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEDLARRFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIVKGQVFFRQTVSSECQHLIRWCLALRPSDRPSFEEIQNHPWMQDDLLPQATA
EIHLHSLSPASSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcctgtccaagatcaactccctggcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgccgggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgttgggcagcggtggcttcggctcggtctactcgggcatccgcgtcgccgac
aacttgccggtggccatcaaacacgtggagaaggaccggatttccgattggggagaactg
cccaatggcacccgagtgcccatggaagtggtcctgctgaagaaggtgagctcggacttc
tcgggcgtcattagacttctggactggttcgagaggcccgatagtttcgtgctgatcctg
gagaggcccgaaccggtgcaagacctcttcgactttatcaccgagcgaggagccctacag
gaggacctggctcgaagattcttctggcaggtgctggaggccgtgcggcattgccacaac
tgcggggttctccaccgcgacatcaaggacgagaacatcttaatcgacctgagccgcggc
gaactcaaactcatcgacttcgggtcgggggcgctgctcaaggacacagtctacacggac
tttgatgggacccgagtgtacagtcctccagagtggattcgctaccatcgctaccacggc
aggtcggcagctgtctggtccctcgggatcctgctctatgacatggtctgcggagatatt
ccgtttgagcacgacgaagagatcgtcaagggccaagtgttcttcaggcaaacggtctct
tcagagtgtcagcaccttattagatggtgcctggccctgagaccgtcagaccggccctcc
tttgaagaaatccagaaccatccgtggatgcaggatgatctcctaccccaggcaaccgct
gagatccatctgcacagtttgtccccggcgtccagcaagtag

DBGET integrated database retrieval system