KEGG   Mus pahari (shrew mouse): 110338078
Entry
110338078         CDS       T05929                                 

Gene name
Ctgf
Definition
(RefSeq) connective tissue growth factor
  KO
K06827  connective tissue growth factor (insulin-like growth factor-binding protein 8)
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110338078 (Ctgf)
   04371 Apelin signaling pathway
    110338078 (Ctgf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110338078 (Ctgf)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    110338078 (Ctgf)
SSDB
Motif
Pfam: TSP1_CCN Cys_knot VWC IGFBP TSP_1
Other DBs
NCBI-GeneID: 110338078
NCBI-ProteinID: XP_021076945
Ensembl: MGP_PahariEiJ_G0023810
LinkDB
Position
21
AA seq 346 aa
MLASVAGPIALVLLALCTRPATGQDCSAQCQCAAEAAPRCPAGVSLVLDGCGCCRVCAKQ
LGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGSVYRSGESFQSSCKYQ
CTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDRTVVGPALAAYR
LEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNTFCTLEKQSRLCMVRPCE
ADLEENIKKGKKCIRTPKIAKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTTLPV
EFKCPDGEIMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgctcgcctccgtcgcaggtcccatcgccttggtgctcctcgccctctgcacccggcct
gccaccggccaggactgcagcgcgcagtgtcagtgcgcagccgaagcggcgccgcgctgc
cccgccggcgtgagcctggtgctggacggctgcggctgctgccgcgtctgcgccaagcag
ctgggagaactgtgcacggagcgtgacccctgcgatccacacaagggcctcttctgcgac
ttcggctcccccgccaaccgcaagatcggcgtgtgcactgccaaagatggtgccccctgt
gtcttcggtgggtcggtgtaccgcagcggggagtccttccaaagcagctgcaaataccaa
tgcacttgcctggatggggccgtgggctgcgtgcccctgtgcagcatggatgttcgcctg
cccagccctgactgccccttcccgagaagggtcaagctacctgggaaatgctgtgaggag
tgggtgtgtgacgagcccaaggaccgcacagtagttggccctgccctagctgcctaccga
ctggaagacacatttggcccagacccaaccatgatgcgagccaactgcctggtccagacc
acagagtggagcgcctgttctaagacctgtgggatgggcatctccacccgggttaccaat
gacaataccttctgcacactggagaagcagagtcgcctctgcatggtcaggccctgtgag
gctgacctggaggaaaacattaagaagggcaaaaagtgcatccggacacctaaaatcgcc
aagcctgtcaagtttgagctttctggctgcaccagtgtgaagacataccgggctaagttc
tgcggggtgtgcactgacggccgctgctgcacaccgcacagaaccaccactctgccagtg
gagttcaaatgccccgatggcgagatcatgaaaaagaacatgatgttcatcaagacctgt
gcctgccattacaactgtcccggggacaacgacatctttgagtccctgtactacaggaag
atgtatggagacatggcgtaa

DBGET integrated database retrieval system