KEGG   Mus pahari (shrew mouse): 110338094Help
Entry
110338094         CDS       T05929                                 

Gene name
Eif3a
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110338094 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mpah03012]
    110338094 (Eif3a)
Translation factors [BR:mpah03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110338094 (Eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 110338094
NCBI-ProteinID: XP_021076973
Ensembl: MGP_PahariEiJ_G0014609
LinkDB All DBs
Position
1
AA seq 1353 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVNAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERKITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRETRDDERPHRRDEDRLRRLGGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGTDDDRPSWRNADDDRPPRRIGDDDRGSWRHTDDERPPRR
GLDDDRPPRRGLDDERGSWRTADEDRGPRRGMDDDRGPRRGADDERSSWRNADDDRGPRR
GMDDDRGPRRGLDDDRGPWRNAAEDRISRRGADDDRGPWRNMDDDRIPRRGDDARPGPWR
PFVKPGGWREKEKAREESWGPPRESRPSEEREWDRDKEKDRDNQDREENDKDLERDRDRE
RDGDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDREDRRRDRDDRRDLRDLRDRR
DLRDDRDRRGPPLRSEREEASSWRRTDDRKDDRTEERDPPRRVPPPALSRDREREREREG
EKEKASWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaagcgcgccaacgaatttcttgag
gttggcaaaaagcagcctgccctggatgttctttatgatgtaatgaaaagtaagaagcac
agaacatggcagaagatacatgagccaattatgttgaaatacttggaactgtgtgtggat
cttcgtaagagccacttggctaaggaagggttatatcaatataagaacatatgccagcag
gtaaacattaaatctttagaagatgttgttagggcatatttgaaattagcagaggaaaaa
acagaagctgctaaagaagagtcccaacaaatggtgttagacatagaagatctggataat
attcagactcctgagagtgttctcttaagtgcagtaagtggggaagatactcaggatcgt
actgacagattgctactgactccctgggtcaagttcctatgggaatcatacaggcagtgt
ttggaccttcttcgaaacaattctagagtagagcgcctttaccatgatatcgcccaacaa
gctttcaaattctgcctccagtatactcggaaggctgagttccgcaagctatgtgacaac
ttgcgaatgcacttatcccagattcagcgccaccataaccaaagcacagcaattaatctt
aataatccagagagccagtccatgcatttggaaaccagacttgttcagttggacagtgct
atcagcatggaattatggcaggaagccttcaaagctgtggaagatattcatggactattt
tccttgtctaagaaaccacctaagcctcagctgatggcaaattactataacaaagtttca
acagtgttttggaaatctggaaatgctttgttccatgcatctacacttcatcgtctttat
catctgtctagagaaatgagaaagaatcttacacaagaagagatgcaaagaatgtctact
agagtccttttggcaactctttccattcctattactcctgagcgaactgatattgctcga
cttttggatatggatggtattatagttgagaagcagcgacgccttgccacattgctaggt
cttcaagccccacccacacgaatcggcctaattaatgatatggtcaggttcaatgtgcta
cagtatgttgtcccagaagtgaaagacctttacaactggttggaggtggaattcaaccca
ctaaaactctgtgagagagttacaaaggtattaaattgggttagggaacaacctgaaaag
gaaccagaattgcaacaatatgtaccacaactccagaacaataccatactccgccttctg
caacaggtggcacagatttatcagagcattgaattttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagccaggcactgtgacctg
caggtacgaattgaccatacttctcggactctgagttttggatcagatttgaattacgca
actcgagaagatgccccaattggtcctcatctgcagagcatgccttcagaacaaataaga
aatcaactcacagccatgtcctcagtgcttgctaaagcacttgaagtcatcaaacctgct
cacattctgcaagagaaagaagaacagcatcagttggcagttaatgcatatcttaaaaat
tcaagaaaagagcaccagaggatcctggctcggagacagacaattgaggaaagaaaagaa
cgtcttgagagtctgaatattcaacgtgagaaggaagaactagagcagagggaagctgaa
ctccagaaagtacggaaggctgaagaagaaaggctgcgccaagaggcaaaggagcgagag
aaggaacgaatccttcaagaacatgagcaaatcaaaaagaaaactgttcgggagcggtta
gagcagatcaagaagacagagctgggcgccaaagcatttaaagatattgacattgaagac
cttgaagaactggatccagattttataatggccaaacaggttgaacaactagagaaagaa
aagaaggaacttcaggaacgcctgaagaatcaagaaaagaagattgactattttgagaga
gctaagcgtttggaagaaattcctttaataaagagtgcatatgaggaacaaagggttaaa
gacatggacctgtgggaacagcaagaagaagaaagaattactacaatgcagctagaacga
gaaaaagctctggagcataagaataggatgtcacgaatgttggaagacagagatctattt
gtgatgcggctcaaagctgcccggcagtctgtctatgaggaaaaactgaaacagtttgaa
gagcgtttagcagaagaaaggcataatcgcctagaagaacgaaaaaggcagcggaaagaa
gaacgcaaaataacttattacagagaaaaggaagaagaagagcagaggagggcagaggag
cagatgctcaaagagcgagaagaaagagagcgtgctgagagagcaaaacgggaggaagaa
cttagagagtatcaggagcgagtcaagaaactagaagaagtagaaaggaaaaagcggcaa
agagagctggaaattgaagaaagggaaaggcgcagagaggaagaaaggagacttggtgat
gatccactttctaggaaggactctcggtggggagatagagattcagaaggcacctggaga
aaaggaccagaagctgactctgagtggagaagaggcccaccagaaaaggagtggagacga
gaaactcgggatgatgagaggcctcacaggagagatgaggatcggctgaggcgcttgggg
ggggacgatgaagagagagagtcttctcttagacctgatgatgatcgcatccccaggcgt
ggcctggatgatgacagagggcctagacgtggtcccgatgaagatagattttctcgtaga
ggaacagatgatgaccgtccttcctggcgtaatgcagatgatgacaggcctcccaggcga
attggtgatgatgacaggggaagctggcgtcacacagatgacgagagaccacccagacgg
ggactagatgatgacagaccacccagacggggactggatgatgagagaggaagctggcgc
acagcagatgaggacagaggacctagacgtgggatggatgatgaccgggggccaagacga
ggtgctgatgatgaacggtcatcctggcggaatgctgatgatgacaggggtcccaggaga
ggcatggatgatgataggggtcccaggcgagggttggatgatgaccgaggaccttggagg
aacgctgctgaagataggatttccaggagaggtgcagatgatgaccgagggccttggaga
aatatggatgatgatcggattcctagacggggtgatgatgcaagacctggtccttggaga
ccatttgtcaagccaggtggatggagagagaaagaaaaggctagagaagagagttggggt
ccacctcgagaatcaagaccatcagaagaacgtgaatgggatagagacaaagagaaggac
agagataatcaagatcgagaggagaatgacaaggaccttgaacgagatagggacagagag
agagatggggaccgggaggatcgtttcagaagacccagggatgaaggtggctggagaaga
ggaccagcagaagaatcttcaagctggagagattcaagtcgtcgtgatgatagagacagg
gaagaccgtcggcgggatagagatgatcgtcgtgatctgagagacctgagagacagaagg
gatttaagagatgatagagatcggagaggacctcccctcagatcagagcgagaagaagca
agctcttggagacgcactgatgacaggaaagatgaccggactgaagagagggatccacct
cgtcgtgttcctcccccagctctttctagagatcgagaaagagagcgagaacgagaaggt
gagaaagagaaagcatcctggagagctgagaaagatagggagtcccttcgtcgtactaag
aatgaaactgatgaagatggatggaccacagtacgacgttaa

DBGET integrated database retrieval system