KEGG   Mus pahari (shrew mouse): 110338132Help
Entry
110338132         CDS       T05929                                 

Gene name
Caskin1
Definition
(RefSeq) caskin-1 isoform X1
  KO
K21952  CASK-interacting protein
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110338132 (Caskin1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110338132 (Caskin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Caskin-Pro-rich Ank_4 SAM_1 Caskin-tail Ank SAM_2 Ank_3 Caskin1-CID SH3_2 SH3_1 SH3_9 NCD1
Motif
Other DBs
NCBI-GeneID: 110338132
NCBI-ProteinID: XP_021077033
Ensembl: MGP_PahariEiJ_G0023505
LinkDB All DBs
Position
21
AA seq 1425 aa AA seqDB search
MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNG
NTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNVPSDEGHIPLH
LAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPR
PGDTTDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLL
LDSGINAQVRNTYSQTALDIVHQFTTSQASKEIKQLLREASAALQVRATKDYCNNYDLTS
LNVKAGDVITVLEQHPDGRWKGCIHDSRTGNDRVGYFPSSLGEAIVKRAGSRTGSEPSPP
QGGGSLGPSAPPEEIWVLRKPFAGGDRSGSLSNAAGGRSPGGHALHAGSEGVKLLATVLS
QKSVSESSPGDSPVKPPEGSSGAARSQPPAAHAGQVYGEQPPKKLESASASEGKSAEAVS
QWLATFQLQLYAPNFTSAGYDLPTISRMTPEDLTAIGVTKPGHRKKITAEISGLNIPDWL
PEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLA
VRKLAELQKAEYSKYEGGPLRRKTPQSLEMMAIESPPPSEPTTAECQSPKMTTFQDSELS
GELQAALSGPAEAGAAAAEKSSNHLPPTPRTNLRESSLSGRARHMSSSQELLGDGPPGPG
SPMSRSQEYLLDEGPAPGTPPKEVRSSRHGHSVKRASVPPVPGKPRQVLPSGASHFTPPQ
TPTKAQPGSPQAHGPATAKVKPTPQLLPPTDRPMSPRSLPQSPTHRGFAYVLPQPVEGEV
GPPAPGPVPPPVPAAVPTLCLPPETDVEPGRPKKRAHSLNRYAASDSEPERDELLVPAAA
GPYATVQRRVGRSHSVRAPAGTDKNVNRSQSFAVRPRKKGPPPPPPKRSSSAMASATLAD
EPAPDVEAEDGRLGVRAQRRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAIRRPP
EGHPTPRPASPEPGRVATVLASVKHKEAIGPDGEVVNRRRTLSGPVTGLLATARRGSGEP
AEQSHFMEDGTARQRLRGPAKGEASAEGPPLARVEASATLKRRIRAKQSQQENVKFILTE
SDTVKRRPKAKEPDAGPEPPPPLSVYQNGTATVRRRPASEQTGPPELPPPPPPAEPPPAD
LMQLPPLPLPDSNARKPVKPPVSPKPILAQPVSKIQGSPTPASKKVPLPGPGSPEVKRAH
GTPPPVSPKPPPPPTAPKPAKALAGLQSSSATPSPVPSPARQPPAALVKPASSPPSQSAS
PAKPPSPGTPALHVPAKPPRAAASVVSGPPVASDCASPGDSARQKLEETSACLAAALQAV
EEKIRQEDGQGPRASSIEEKSTGSILEDIGSMFDDLADQLDAMLE
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggagctggtgcaggcggtgaaggcggaggacgtggggaccgcgcag
aggctgctgcagaggccgcggccggggaaggccaagctcctgggctctaccaagaagatc
aatgtcaacttccaggacccggatggcttctcagccctgcaccatgccgccctgaatggc
aacacagaattgatctctctcctgctggaggctcaggctgctgtagacatcaaggacaac
aaaggtatgcggccgttgcactatgctgcctggcagggccggaaggagcccatgaagctg
gtgctgaaggcgggctcagcagtaaatgtcccatccgacgaaggccacatacccctgcat
ttggctgcccagcatggtcactacgatgtgtcagagatgctgctgcagcatcagtccaac
ccctgcatggtagacaactctggaaagacacctctggacctggcctgtgagtttggccgc
gtaggggtggtccagctgctgctaagtagcaacatgtgtgcagccttgctggagccccga
ccaggggacaccaccgaccccaatggcaccagccccctgcacctagcagccaagaatggc
cacattgacatcatcaggctgcttcttcaggccggcatcgacattaaccgccagaccaag
tctggcacggctcttcatgaagccgcgctctgtgggaaaacagaagtggttcggctactg
ttggatagtgggatcaatgctcaggtgaggaacacctacagccagacggcactggacatc
gtacaccaatttacaacgtcccaggccagcaaggagattaagcaactgcttcgagaggcc
tcagcagccctgcaggtccgggcaacaaaggattactgtaacaattatgatctgaccagt
ctcaatgtgaaggctggggacgttatcacggtacttgaacagcaccccgatggccggtgg
aaaggctgcattcatgacagccggacaggcaatgacagggtgggctacttcccatcttcc
ctgggggaggctatcgtcaagcgagcaggttcccggacaggcagtgagccaagcccaccc
cagggaggtggctcactgggtccctctgcacccccggaggagatctgggtgctgaggaag
ccttttgcgggtggagatcgcagtggcagcttgagcaatgcggctgggggcaggagtcct
gggggccatgccttgcatgcaggctctgaaggagttaagctcctggcaacggtgctttcc
cagaagtcagtctccgagtccagcccaggagatagcccggtcaagcctccagagggctct
tcaggtgcggcccggtcccagcctccagcagcccatgctgggcaggtgtatggggagcag
ccacccaagaagctggaatcggcctcggcctctgagggcaagagtgctgaggcagtcagt
cagtggcttgccacattccagctacagctctatgcccccaacttcaccagcgctggctat
gacctgcccaccatcagtcgtatgacccctgaggacctcacagccattggtgtcaccaag
ccaggccaccgtaagaagattacggcagagatcagcggcctgaacatccctgactggctg
cctgaacacaaacccgctaacctggctgtgtggctatcaatgattggtctggcccagtat
tacaaggtgctggtggacaacggctacgagaacattgatttcatcactgatatcacctgg
gaggacctgcaggagatcggcatcaccaagctgggacaccaaaagaagctgatgctggca
gtgaggaaactggcagagctgcaaaaggcagaatactccaagtatgaggggggacccctg
cgccgaaagacaccccaatcacttgaaatgatggctattgaatcgccgcccccatctgag
cccactacagcagagtgccagtctcccaagatgaccaccttccaggacagcgaactcagt
ggggagctgcaggccgccctgtccggcccagctgaagcaggtgcagctgctgctgagaaa
tcctccaaccacctgccacccaccccgaggacaaacttacgggagtccagcctgagcgga
cgggctcggcacatgagcagctctcaggagctgctgggtgatgggcctccggggcctggc
agtcctatgtcacgaagtcaggaatacctgctggatgaggggccggctcctggcacccca
cccaaggaggtgcggtccagccgccacggccacagcgtcaagagggccagtgtgcccccg
gtgcccggcaagccacgacaggtccttccatctggtgccagccacttcacacccccacag
acgcccaccaaagctcagccgggctcccctcaggcccatggtccagccacagccaaggtg
aagcccaccccacagctgctaccaccaacagaccgacccatgtcgccccgttccctgcct
cagtcacccacacaccgtggctttgcctatgtgctgcctcagccagttgaaggcgaggta
gggccgcctgctccaggacctgtgcccccaccagtacccgcagctgtgcctacactatgc
ttgcccccagaaactgacgtagagcccgggaggcccaagaaacgtgcccacagcttgaat
cgctatgcagcatctgacagtgagcctgagagggatgagctgctggtgccggctgccgcc
ggaccctatgccacagtccagaggcgtgtgggtcggagccattcggtgagggctcctgct
ggcacggacaagaatgttaaccgcagtcagtcctttgctgtgcggccacgtaagaagggg
cccccaccacctccacccaaacgctccagctcggccatggccagtgccaccctagccgac
gagccggctcctgatgttgaggcagaggacggccggctgggggtccgggcgcaacgccgt
cgggctagtgatctcgctggcagtgtggacacaggcagtgctggcagtgtgaagagcatt
gcagccatgttggagctgtcttccattgggggcgggggacgggctattcgcaggcccccc
gaaggccaccccacacctcgtcccgccagtccggaaccaggccgagtagctaccgtgttg
gcctctgtgaagcacaaagaggccattgggcctgacggtgaagtggtgaaccggcgccgt
acactcagtggcccagtcactggacttttggccactgctcgacgggggtctggggaacct
gcagaacagagtcattttatggaggatggcacagcccgacaacggcttcgaggtccagct
aagggtgaggcaagtgcggagggccctccccttgcccgggtagaggccagtgccacgctc
aagaggcgcatccgggccaagcagagccaacaagagaacgtcaagttcatcctgacggag
tctgacacggtgaagcgcaggcctaaggctaaggagcctgacgctggccctgagccgccc
ccaccactgtctgtgtatcagaacggcacagccacagttcgccgaaggccagcctcagag
cagactgggcctccagagctgccccctcctcctcctcctgctgagcccccacctgctgac
ctgatgcagctgcctccactgcccctgcctgacagcaatgcacggaagccggtgaagcca
cccgtctctcccaagcccattctggctcagcctgtgtccaagatccagggctcacctaca
cctgcctccaagaaggtgccactgccaggccctggcagcccagaggtaaagcgtgctcac
ggcacgccaccgcccgtgtcacccaagcctccgccaccacctacagcacccaagccagcc
aaggctttggcgggactacagtccagcagcgccaccccctcgcctgtgccctcgccagcg
cgtcagccgccagcagccctcgtcaagccagctagctcgccgccctctcagagcgccagc
cccgccaagcccccttccccagggacgcccgcactgcacgtacccgccaagccccctcgc
gctgccgcttcagtagtctccggacccccagtagcttcagattgtgcttcgcccggggac
agcgctcggcagaagctggaagagactagcgcgtgtttggctgcagcactgcaggcagtg
gaggagaagataaggcaggaagacggacaagggcctcgcgcctcctccatcgaggagaag
agcactggcagcatcctggaagacatcggcagcatgttcgacgacctggccgaccagctg
gacgccatgctggagtga

DBGET integrated database retrieval system