KEGG   Mus pahari (shrew mouse): 110338236
Entry
110338236         CDS       T05929                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04630  JAK-STAT signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110338236 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    110338236 (Cdkn1a)
   04066 HIF-1 signaling pathway
    110338236 (Cdkn1a)
   04068 FoxO signaling pathway
    110338236 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    110338236 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110338236 (Cdkn1a)
   04115 p53 signaling pathway
    110338236 (Cdkn1a)
   04218 Cellular senescence
    110338236 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110338236 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    110338236 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338236 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    110338236 (Cdkn1a)
   05206 MicroRNAs in cancer
    110338236 (Cdkn1a)
   05205 Proteoglycans in cancer
    110338236 (Cdkn1a)
   05203 Viral carcinogenesis
    110338236 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110338236 (Cdkn1a)
   05212 Pancreatic cancer
    110338236 (Cdkn1a)
   05225 Hepatocellular carcinoma
    110338236 (Cdkn1a)
   05226 Gastric cancer
    110338236 (Cdkn1a)
   05214 Glioma
    110338236 (Cdkn1a)
   05216 Thyroid cancer
    110338236 (Cdkn1a)
   05220 Chronic myeloid leukemia
    110338236 (Cdkn1a)
   05217 Basal cell carcinoma
    110338236 (Cdkn1a)
   05218 Melanoma
    110338236 (Cdkn1a)
   05211 Renal cell carcinoma
    110338236 (Cdkn1a)
   05219 Bladder cancer
    110338236 (Cdkn1a)
   05215 Prostate cancer
    110338236 (Cdkn1a)
   05213 Endometrial cancer
    110338236 (Cdkn1a)
   05224 Breast cancer
    110338236 (Cdkn1a)
   05222 Small cell lung cancer
    110338236 (Cdkn1a)
   05223 Non-small cell lung cancer
    110338236 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110338236 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110338236 (Cdkn1a)
   05161 Hepatitis B
    110338236 (Cdkn1a)
   05160 Hepatitis C
    110338236 (Cdkn1a)
   05163 Human cytomegalovirus infection
    110338236 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110338236 (Cdkn1a)
   05169 Epstein-Barr virus infection
    110338236 (Cdkn1a)
   05165 Human papillomavirus infection
    110338236 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110338236 (Cdkn1a)
   01522 Endocrine resistance
    110338236 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110338236
NCBI-ProteinID: XP_021077176
Ensembl: MGP_PahariEiJ_G0023655
LinkDB
Position
21
AA seq 162 aa
MSDPDDVRPVPHRSKVCRRLFGPVDSEQLRRDCDALMAGCLQEARERWNFDFITETPLEG
NFVWERVRSLGLPKVYLSPGSRGRDDLGGDKRPSTSSALLQGPAPEDHVALSLSCTLVSH
APERPEDSPGGPGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtccgatcctgatgatgtccgacctgttccgcacaggagcaaagtgtgccgtcgtctc
ttcggtcccgtggacagtgagcagttgcgccgtgattgcgatgcgctcatggcgggctgt
ctccaggaggcccgagaacggtggaactttgacttcatcacggagacgccgctcgagggc
aacttcgtctgggagcgcgttcggagcctagggctgcccaaggtctacctgagtcctggg
tctcgcggccgtgacgacctgggaggggacaagaggcccagtacttcctctgccctgctg
caggggccagctccggaggaccacgtggccttgtcgctgtcttgcactctggtgtctcat
gcccctgagcggcctgaagactccccgggtgggcctggaacatctcagggccgaaaacgg
aggcagaccagcctgacagatttctatcactccaagcgcagattggtcttctgcaagaga
aaaccctga

DBGET integrated database retrieval system