KEGG   Mus pahari (shrew mouse): 110339070Help
Entry
110339070         CDS       T05929                                 

Gene name
Galnt17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00512  Mucin type O-glycan biosynthesis
mpah00514  Other types of O-glycan biosynthesis
mpah01100  Metabolic pathways
Module
mpah_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110339070 (Galnt17)
   00514 Other types of O-glycan biosynthesis
    110339070 (Galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mpah01003]
    110339070 (Galnt17)
Enzymes [BR:mpah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110339070 (Galnt17)
Glycosyltransferases [BR:mpah01003]
 O-Glycan biosynthesis
  Mucin-type
   110339070 (Galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 110339070
NCBI-ProteinID: XP_021078201
Ensembl: MGP_PahariEiJ_G0024380
LinkDB All DBs
Position
23
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWAIKNPIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgaggagagtcaaagtgttgttggtattgaacttgatagcggtggccggc
ttcgtgatctttttggctaagtgtcggcctatcgcggtgcgcagcggagacgccttccac
gagatccggcctcgcgcagaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcttgtcgctgctggaggacatcgtctaccggcagcttaatggc
ttatctaaatccctcgggctcatcgaagggtatggtgggaggggcaaagggggccttcct
gccaccctttccccctctgaagaagaaaaagccaaaggacctcatgagaaatatggctac
aattcctacctcagtgaaaagatctccttggaccggtctattccagattatcgtcctacc
aagtgtaaggagctcaaatattccaaggagttgccccagatatccatcatcttcatcttc
gtgaatgaggccctgtctgtgatactgcggtcagtccacagcgctgtcaatcacacaccc
acacacctgctgaaggagatcatcctggtggatgacaacagtgatgaagaggagctgaag
gcccccttggaagagtatgtccacaaacgctaccctgggctggtgaaggtggtacgcaat
caaaagagagaaggcttgatccgagcacgcatcgagggctggaaagccgccactggccag
gtcactggctttttcgatgctcacgtggaattcactgctggctgggctgagcccgttctg
tcccgcatccaggaaaaccggaagcgggtcatcctcccctccatcgataacatcaagcag
gacaacttcgaagtgcagcgctacgagaactctgcccatgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagatccctctctccccatc
aggacaccagccatgattggctgctcatttgtggtcaacaggaaattctttggtgaaatt
ggtctgctggaccctgggatggatgtgtatggaggagagaatattgaacttggaatcaag
gtatggctctgtggtggcagcatggaggtccttccgtgttcaagggtggcccacattgag
cggaagaagaaaccgtataacagtaacatcggcttctacaccaagaggaatgcgctgcgg
gtagccgaggtctggatggacgactacaagtcacatgtgtacatagcatggaatctgcct
ctggagaatccaggcatcgacatcggtgacgtctcagaaagaaaagcactgaggaaaagt
ttgaaatgtaagaatttccagtggtatttggaccatgtttacccagaaatgagaagatac
aacaacactatcgcatatggggagcttcgtaataataaggccaaggacgtctgtctggac
cagggtccactggaaaaccacacagcaatactgtacccatgccacggttggggaccacag
ctcgcccgctacaccaaggaaggcttcctgcacttgggtgctctggggaccaccactctc
cttcccgatacccgctgcctggtggacaactccaagagtcggttgccgcagctcctggat
tgtgacaaggtcaagagcagcttgtacaagcgctggaacttcatccagaatggagccatc
atgaataagggcacggggcgctgcctagaggtggagaaccggggtctagccggcatcgac
ctaatccttcgaagctgtacaggacagagatgggcaatcaagaatcctatcaagtag

DBGET integrated database retrieval system