KEGG   Mus pahari (shrew mouse): 110339175
Entry
110339175         CDS       T05929                                 

Gene name
Ptpn11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04014  Ras signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04360  Axon guidance
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04931  Insulin resistance
mpah05168  Herpes simplex virus 1 infection
mpah05205  Proteoglycans in cancer
mpah05211  Renal cell carcinoma
mpah05220  Chronic myeloid leukemia
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110339175 (Ptpn11)
   04630 JAK-STAT signaling pathway
    110339175 (Ptpn11)
   04072 Phospholipase D signaling pathway
    110339175 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110339175 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    110339175 (Ptpn11)
   04670 Leukocyte transendothelial migration
    110339175 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110339175 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110339175 (Ptpn11)
  09158 Development and regeneration
   04360 Axon guidance
    110339175 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110339175 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110339175 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110339175 (Ptpn11)
   05211 Renal cell carcinoma
    110339175 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110339175 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110339175 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110339175 (Ptpn11)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110339175 (Ptpn11)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    110339175 (Ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase Tab2_like
Other DBs
NCBI-GeneID: 110339175
NCBI-ProteinID: XP_021078372
Ensembl: MGP_PahariEiJ_G0024257
LinkDB
Position
23
AA seq 593 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcaccccaacatcactggtgtggaggcagagaatctcttg
ctgaccagaggagtcgatggcagttttttagcaaggcccagtaagagtaaccctggagac
ttcactctgtctgtcagaagaaatggagccgttacccacatcaagattcagaacactggg
gactactatgacctctatggtggggagaagtttgccaccttggctgaactggtccagtat
tacatggaacaccatgggcagctgaaagagaaaaatggagatgtcatcgagctcaagtac
ccgctgaactgtgcagaccctacctctgaaaggtggttccacggtcacttgtctggaaaa
gaagcagagaagctgctgacggagaagggcaaacatggcagcttcctcgtccgagagagc
cagagccaccccggagacttcgttctctcagtgcgcactggtgacgacaaaggggagagc
aacgatgggaagtccaaagtgacccacgtcatgatccgctgtcaggagctgaaatacgac
gttggtgggggagagcgctttgactctctgacagacctggtggaacattacaagaagaac
cccatggtggagactctgggcacagtcctgcagctcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatcgaaagccgggttcgagagttaagcaagctggctgagaccaca
gataaagtcaagcagggcttttgggaagagtttgagacgctacaacaacaggaatgcaaa
cttctctacagccgaaaagaaggacagagacaagaaaataaaaacaaaaacagatacaaa
aacatcctgccctttgatcataccagggtcgttctgcacgatggggatcccaatgagcct
gtttctgattacatcaacgcaaacatcattatgcctgagtttgagaccaagtgcaacaat
tccaaacccaaaaagagttatatcgccactcaaggctgcctgcagaacaccgtgaatgac
ttctggcggatggtgttccaggagaactctcgagtcattgtcatgaccacaaaggaagtg
gagagagggaagagcaaatgtgtcaagtactggcctgatgagtatgcgctcaaagaatac
ggggtcatgcgtgttaggaacgtcaaagaaagtgctgcccacgactacaccttacgagag
ctcaaactctctaaggtcggacaaggaaacacagagagaaccgtctggcagtaccacttt
cggacctggccagaccatggcgtgcctagtgaccctggaggtgtgctggacttcctggag
gaggtccaccataagcaggagagcatcgtggatgcaggccctgtcgtggttcactgcagt
gccgggattggccggacaggaacgttcattgtgattgatatccttatcgacatcattcga
gagaaaggtgtggactgtgacatcgacgttcctaaaaccattcagatggtgcggtcccag
aggtcagggatggtccagacagaagcacaataccggttcatctacatggccgtccagcat
tacatagagacgctgcagcgccggatcgaggaggagcagaaaagcaaaaggaaaggacat
gaatataccaatattaagtattccctggtggaccagacaagtggtgatcagagtcccctg
ccaccttgcaccccaacaccaccctgtgcagaaatgagggaggacagtgcccgagtctat
gagaacgtgggcctcatgcagcagcagaggagtttcagatga

DBGET integrated database retrieval system