KEGG   Microbacterium paludicola: BO218_05345Help
Entry
BO218_05345       CDS       T04601                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mpal  Microbacterium paludicola
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpal01001]
    BO218_05345
Enzymes [BR:mpal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BO218_05345
Protein kinases [BR:mpal01001]
 Serine/threonine kinases: Other
  Bacterial family
   BO218_05345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Pkinase_fungal Kdo Haspin_kinase FTA2 RIO1
Motif
Other DBs
NCBI-ProteinID: APF33686
LinkDB All DBs
Position
1108193..1110148
Genome map
AA seq 651 aa AA seqDB search
MSMSQQTDPLIGRLVDQRYRVRARIARGGMATVYVATDLRLERRVALKVMHGHLSDDSVF
QSRFIQEARSAARLADPHVVNVFDQGQDGEMAYLVMEYLPGITLRELLREQRRLTIPQTI
TIMDAILSGLAAAHRAGIVHRDVKPENVLLAEDGRIKIGDFGLARATTANTATGQMLLGT
IAYLAPELVTRGTADARSDIYALGIMLYEMLAGEQPYKGEQPMQIAYQHATDSVPRPSAK
NPGVPEQLDELVLWATEREPDERPLDAKVMLERLREIERELGVFPQVVRTAPSGAPAVVI
DDDGEGSGELTKVMPGTFTAPPVTTDVDNATRLRRLTRRNRAKGAWLVTIVLLLAALAGG
TGWWFGSGPGSLVAVPDVRGTTFAEAQSAIAAQGLQAQEAGENSLDVAEGLAIRTDPDPG
ARLDRDAIVTVVISRGPAEVSIPALAGQTEQAAREILRQNIVAVSNDADAEFDPDVADGT
VIRVSATPAGGGDPVDCSDGCTLRQGDSASLLVSRGAVPDVSGQSVDRATATLTDVGLQV
SGDTRAQSSDRIAKGDVIGIDDRGEEGNWRPGDTVTLIVSSGPPLFDVPSVVGQTRDAAA
KTLRDAGFEVSFSALWNIWPDGLTKVTAQDPAGGSKHVRGTTITLQITATG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgagccagcagaccgacccgctgatcggccgactggtcgaccagcggtaccgc
gtccgtgctcgcatcgcccgaggggggatggcgacggtgtacgtcgcgaccgacctcaga
ctcgagcgccgcgtggccctgaaggtcatgcacgggcacctgtcggacgactcggtcttc
cagagccggttcatccaggaggcgcgctccgccgcccggctcgccgacccgcatgtcgtg
aacgtcttcgaccagggtcaggacggcgagatggcctacctggtcatggagtacctgccg
ggcatcaccctgcgcgagctgctgcgcgagcagaggcggctgaccattccccagacgatc
acgatcatggacgcgatcctctcgggtctcgccgccgcgcaccgcgccgggatcgtgcac
cgcgacgtcaagcccgagaacgtgctgcttgccgaggacgggcgcatcaagatcggcgac
ttcggactcgcgagagcgacgacggcgaacacggcgaccgggcagatgctcctgggcacg
atcgcctacctcgcgccggagctcgtgacacggggcaccgccgatgcccgcagcgacatc
tacgccctcggcatcatgctctacgagatgctcgccggcgagcagccctacaagggcgag
cagccgatgcagatcgcctaccagcacgcgaccgactcggtgccccgcccgagcgcgaag
aaccccggcgtcccggaacagctcgacgagctggtgctgtgggcgaccgagcgcgaaccc
gacgagcgtccgctcgacgcgaaggtcatgctcgagcgtctgcgcgagatcgagcgcgag
ctcggcgtgttccctcaggtggtgcgcaccgccccctccggcgcgccggcggtcgtcatc
gacgacgacggcgaaggatcgggcgagctcacgaaggtcatgcccggcaccttcacggca
cctccggtgaccaccgacgtcgacaacgcgacgcgactgcgccgcctcacccgccgaaac
cgggcgaagggcgcctggctcgtcaccatcgtcctgctgctcgcggctctcgccggcggc
accggatggtggttcggctccgggccgggatcgctcgtcgccgtacccgacgtacgcggc
acgaccttcgccgaagcgcagagcgccatcgcggcacagggcctgcaggcccaggaggcc
ggcgagaacagcctcgacgtcgcagagggtcttgcgatccgcaccgaccccgaccccggc
gcacggctcgaccgcgacgcgatcgtgaccgtggtcatctcgcgcggaccggcggaggtg
tcgatcccggccctcgccggccagaccgagcaggcggctcgagagatcttgcggcagaac
atcgtcgccgtgtcgaacgatgccgatgcggaattcgatccggatgtcgccgacggcacc
gtcatccgcgtctcggcgaccccggccggaggcggcgatcccgtggactgctcagacggc
tgcacgctccgccagggagactcggccagcctgctcgtgtcgcgcggggccgtgccggac
gtctcgggccagagcgtcgaccgggcgaccgccaccctcaccgacgtcggcctccaggtg
tcgggcgacacccgcgcgcagtcgagcgatcgcatcgccaagggcgatgtcatcggcatc
gacgaccgcggcgaagaaggcaattggcggccgggtgacaccgtgaccctcatcgtctcg
agcgggcccccgcttttcgacgtgccgagcgtcgtcggccagacgcgcgatgcagccgcc
aagacgctgcgcgacgcgggtttcgaggtcagcttctcggccctgtggaacatctggcct
gacgggctgaccaaagtcaccgcccaggaccccgccggcggtagcaagcacgtgcgcggc
acgaccatcaccctgcagatcaccgcgaccggctga

DBGET integrated database retrieval system