KEGG   Microbacterium paludicola: BO218_06770Help
Entry
BO218_06770       CDS       T04601                                 

Definition
(GenBank) hypothetical protein
Organism
mpal  Microbacterium paludicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 SNAP ANAPC5 TPR_16 DUF3856 TPR_19 TPR_10
Motif
Other DBs
NCBI-ProteinID: APF33924
LinkDB All DBs
Position
1404664..1407450
Genome map
AA seq 928 aa AA seqDB search
MSSDRILELFEQIDRTPVGVEERALINEAIALAVDAGDEPLEYRARMRLTSSACMSGDTE
AMLTSFAWCLGKHDDDPERFPADLGDETADLMWQFKWMADSLAASPAFDREQIAAVLDDM
ENHYRAAGLGQSGVLMARFENAWMAGRLEEAEQLRTKLETTPRDSHSHCEACVRSVVAGY
LIDTDREDEAIRLVEELVEGDFSCGEEPEHALARSLVPYLHAGEYDKARLAHLRSYRLAK
DNADNLAIVADNIVFCAITGNEARALSLVERHLDWLAHDALGVDGHLSALTAFAIALEAV
SAAGHADTIVRGADSERLRAFFGENDGPWRAAELAAVMRSEAERIAGEFDRRDGTDGHRR
RLDRAWAVGQERYSLPLSAEPLLPRVAPVAARSAEELVQRAIDLGDYGASEALAAADAAL
PGATLDQRAKLHSARIAALVARDDLEGAQAALHDRLDALRAVGRDAEAQVEERAGLALFG
RGAPGDLETLREVLADGESLPPRLHAIVEVVVGMAVAETDPETARGLFDDARDREAALGD
DDLRRIVALARASFQGAIGAFDECDATITAALEDPALGAGARARLLGLRARMRGGQERFL
DGVADADELCRILVELDARSVLAGAYVLAAALNEDAGAPGEAVARYRFAERAATENGDSV
TAVQYRLARALLASGSADEAAELLVNVYSDETDREEPAASRAQTLMLLARAFEDAGEPGR
AVGAWEFAAELFDEGEAPVGRANALLSHGRLLHRFGEFDDALASLETAVEIARTEPEQAG
LLAEARHSEGQVRAARGEHEALTAFDEAREIASGLGAPWLVADITDSRARALAMLGQADE
AVATALQAADAFAEVGDTGSAGASELFAARVLAQNERGADAVPLYRSVMERAAEIPPLLQ
VAAGELGDVYEALGRPAEAAEVRALLDA
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaccgtatcctcgaactgttcgagcagatcgaccgcaccccggtcggcgtc
gaagaacgagccctcatcaacgaggccatcgccctcgccgtcgatgcgggcgacgagccc
ctggagtaccgggcgcggatgcgactgacctcgtccgcctgcatgagcggcgacaccgag
gcgatgctgacctccttcgcatggtgcctcggaaagcacgacgatgaccccgaacgcttc
cccgccgacctcggcgacgagaccgccgacctcatgtggcagttcaagtggatggccgac
agcctggccgcgtctccggcgttcgaccgggaacagatcgccgccgtgctcgacgacatg
gagaaccactaccgcgctgccgggctcggtcagagtggcgtcctcatggcgcgcttcgag
aacgcgtggatggccggccgcctcgaggaggccgagcagctgcgcaccaagctcgagacg
acaccccgcgacagccacagccactgcgaggcgtgcgtccgcagcgtcgtcgccggctac
ctcatcgacaccgaccgcgaagacgaggcgatccgcctcgtcgaagagctcgtcgagggc
gacttctcatgcggcgaagagccggagcacgcgctcgcccggtcgctcgttccgtacctg
cacgcgggcgaatacgacaaggcccgcctcgctcacctgcgcagctatcgcctcgcgaaa
gacaacgccgacaacctcgccatcgtggccgacaacatcgtcttctgcgccatcaccggc
aatgaagcacgggcactctcgctcgtcgaacgccacctcgactggctcgcgcacgacgcg
ctcggcgtcgacggccacctctccgccctcaccgccttcgcgatcgctctggaagccgtc
agcgccgcgggacacgccgacaccatcgttcgcggcgccgactccgagcggctccgcgcc
ttcttcggcgagaacgacggcccgtggcgcgccgccgagctcgcggcggtgatgcgttcg
gaggccgagcggatcgccggcgagttcgatcgccgcgacggcaccgacggtcaccgccgc
cgtctcgaccgggcctgggccgtcgggcaggagcgctactcgctccccctcagcgccgag
cccctgctcccccgcgtcgcccccgtggccgcgcgctcggccgaagagctcgttcagcga
gccatcgacctcggcgattacggcgcctcggaagcactggctgcggcggatgcggcgctc
cccggcgcgaccctcgaccagcgcgccaagctccactcggcgcgcatcgccgcccttgtc
gcgcgcgacgacctcgaaggcgcccaggccgctctgcacgaccgtctcgacgccctccgc
gccgtcggtcgcgacgcggaggcccaggtcgaagagcgcgccggcctcgccctgttcgga
cgcggcgcccccggcgacctcgagacgcttcgcgaggtcctcgccgacggcgagagcctg
ccgccccgtctgcacgcgatcgtcgaggtcgtggtgggcatggccgtcgccgagaccgac
cccgagacagcccgcggcctcttcgacgacgcccgcgaccgcgaggccgcgctgggcgac
gacgacctgcgtcgcatcgtcgcgctcgcacgtgcatcgttccagggcgccatcggtgca
ttcgacgagtgcgacgcgacgatcaccgccgcgctcgaggaccccgcgctcggcgccggc
gcccgggcccggctgctcggcctgcgggctcgcatgcgcggcggccaggagaggttcctc
gacggtgtggccgacgccgacgagctctgccgcatcctcgtcgagctcgacgcgcgcagc
gtcctcgccggagcgtacgtgctcgcggccgcgctcaacgaggacgccggtgcgcccggc
gaggcggtcgcccgttaccggttcgccgagcgcgccgcgaccgagaacggcgactccgtg
accgcggtgcagtaccgcctcgcacgggcgctgctcgcatccggctccgccgacgaggcc
gccgagctgctcgtgaacgtctactccgacgagaccgaccgcgaggagcccgcggcgtcg
cgcgcccagacgctcatgctgctggcccgcgccttcgaagacgccggcgaacccggccgt
gcggtcggcgcatgggagttcgccgccgaactgttcgacgaaggagaggcgccggtgggt
cgcgccaacgctctcctgtcgcacgggcgtctgctgcaccggttcggagagttcgacgac
gccctcgcctcgctcgagacggcggtcgagatcgcacgcaccgagcccgaacaggccggg
ctgctcgccgaagcgcggcactcggagggtcaggtccgcgccgcgcgaggcgagcacgag
gcgctgacggctttcgatgaggcccgcgagatcgcttccggtctcggcgccccgtggctc
gtcgccgacatcaccgactcgcgagcccgagcgctggccatgctcgggcaggcggacgag
gcggttgccacggcgctccaggctgccgacgcgttcgcggaggtcggcgacaccggttct
gccggcgcgtccgagctcttcgccgcgcgcgtcctcgcccagaacgagcgcggcgccgat
gcggtcccgctctaccggtcggtcatggagcgtgccgccgagatcccgccgctgctccag
gtggccgccggtgagctcggcgacgtctacgaagcgctcggccgccccgccgaagccgcc
gaggtgcgcgcgctcctcgacgcctga

DBGET integrated database retrieval system