KEGG   Microbacterium paludicola: BO218_06805Help
Entry
BO218_06805       CDS       T04601                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mpal  Microbacterium paludicola
Pathway
mpal00250  Alanine, aspartate and glutamate metabolism
mpal00280  Valine, leucine and isoleucine degradation
mpal00310  Lysine degradation
mpal00410  beta-Alanine metabolism
mpal00640  Propanoate metabolism
mpal00650  Butanoate metabolism
mpal01100  Metabolic pathways
mpal01120  Microbial metabolism in diverse environments
Module
mpal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BO218_06805
   00650 Butanoate metabolism
    BO218_06805
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BO218_06805
   00280 Valine, leucine and isoleucine degradation
    BO218_06805
   00310 Lysine degradation
    BO218_06805
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BO218_06805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpal01007]
    BO218_06805
Enzymes [BR:mpal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BO218_06805
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BO218_06805
    2.6.1.48  5-aminovalerate transaminase
     BO218_06805
Amino acid related enzymes [BR:mpal01007]
 Aminotransferase (transaminase)
  Class III
   BO218_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APF33931
LinkDB All DBs
Position
complement(1415674..1417068)
Genome map
AA seq 464 aa AA seqDB search
MRVARCASYCRGMSTTTSTPTIPLGGPTLPQERRVVTAIPGPRSEELLARKAAAVPAGVG
HTAPIHAVAAGGGVVVDADGNSLIDLGSGIAVTSVGNAHPAVVAAVQAQVAQFTHTCFMI
SPYESYVAVAEALNRLTPGDHEKKTALFNSGAEAVENAVKIARKATGRQAVVAFDHGYHG
RTNLTMALTAKSMPYKSGFGPFAPEVYRAPLSYPFRDGLSGPDAAARAISQIEKQIGADN
LAAVIIEPIQGEGGFIVPADGFLPAVADWCRENGVVFIADEVQTGFARTGAMFASEHFGI
VPDLITTAKGIAAGLPLAAVTGRADLMDASHPGGLGGTYGGNPVACAAALAAIDAFENDG
LTERAQQIGARLTARLNAMRESDPRIGDVRGLGAMIAAEFVDPATGAPDAALTSAIAKAC
IAEGVIVLTCGTYGNVIRFLPPLSIGDELLDDGLDVIAAALGRV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttgcgcgatgcgcgtcctactgtcgcggaatgagcaccacgacctcgacgccg
accatccccctcggcggcccgaccctcccgcaggagcgccgcgtcgtcaccgcgatcccc
ggacctcgctccgaggaactgctggcccgcaaggcagccgccgtcccggccggtgtcggc
cacaccgcgccgatccatgccgtcgccgcgggcggcggagtcgtcgtcgacgccgacggg
aactcgctcatcgacctcggctcgggcatcgccgtgacctcggtgggcaacgcgcatccc
gccgtcgtcgccgctgtgcaggcgcaggtcgcgcagttcacccacacctgcttcatgatc
tcgccgtacgagtcgtacgtcgccgtcgccgaagccctcaaccggctcaccccgggcgac
cacgagaagaagaccgcgctgttcaactcgggcgccgaagcggtcgagaacgccgtgaag
atcgcacgcaaggcgaccggccgccaggcggtcgtcgccttcgaccacggctaccacggc
cggacgaacctcacgatggcgctcaccgcgaagtcgatgccctacaagagcggattcggg
ccgttcgcccccgaggtctaccgtgcgccgctgtcgtacccgttccgcgacgggctgtcg
ggcccggatgccgcagcccgcgcgatctcgcagatcgagaagcagatcggagccgacaac
ctcgccgccgtcatcatcgagcccatccagggcgagggcgggttcatcgtccccgccgac
gggttcctgccggcggtcgccgactggtgccgcgagaacggcgtcgtgttcatcgccgac
gaagtccagaccggcttcgctcgcaccggtgccatgttcgccagcgagcacttcggcatc
gtccccgacctgatcacgaccgcgaagggcatcgcggcgggcctgccgctcgccgcggtc
accgggcgcgccgacctcatggacgcctcgcaccccggtggcctcggcggcacgtacggt
ggcaacccggtcgcgtgcgcggcggcgctcgccgcgatcgacgccttcgagaacgacggc
ctgaccgagcgagctcagcagatcggggcgcgcctgacggcccggctgaacgcgatgcgc
gagagcgacccccgcatcggggatgtgcgcgggctcggcgcgatgatcgccgcggagttc
gtcgaccccgccaccggcgcccccgacgccgcgctgacgtcggcgatcgcgaaggcgtgc
atcgcggagggcgtcatcgtcctcacgtgcggcacctacggcaacgtcatccggttcctt
ccgccgctgtcgatcggcgacgagctgctcgacgacggcctcgacgtcatcgctgcggcg
ctcgggcgggtctga

DBGET integrated database retrieval system