KEGG   Marinomonas posidonica: Mar181_0215Help
Entry
Mar181_0215       CDS       T01508                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpc  Marinomonas posidonica
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mar181_0215
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mar181_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 NAD_binding_8 Glutaredoxin Thi4 HTH_43 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEF53283
UniProt: F6CX29
LinkDB All DBs
Position
complement(238571..240118)
Genome map
AA seq 515 aa AA seqDB search
MLDANMKQQLGTYLQNIVNPIEITVSTNGNDKSAELLALAQDIESLNSSKITLITDENPS
GRAPQMAISPKGEAPRVRFAGIPMGHEFTSLVLALLQAGGHPSKAAQDTLEQIKGLDSEL
NFEVYISLSCHNCPDVVQAVNLMAVLNPKITATMIDGALFQGEVDERNIMAVPSVYLNGE
HFGQGRMTLDEILNKVDTGASDKQAAALSEKEAYDVLIVGGGPAGAAAAIYSARKGIRTG
VVAERFGGQVSDTMAIENFISVKATDGPKLVAGLEQHVLEYDVDLMKTQKAVRLEKKEFV
EVELENGAILKSKSVVLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKKTAVIGG
GNSGIEAAIDLAGIVEHVTVLEFGDTLRADDVLVKKAESLPNVSIIKNAMTTEVLGDDER
VIGLKYTDRKTDESHLVDVAGIFVQIGLVPNSEFLKDTLELTNRGEIVVNGHGETSLPGV
FAAGDVTTAPYKQIIVSMGSGATAALGAFDYLIRH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaatatgaaacaacaattgggcacctaccttcaaaatatcgttaatccg
attgagattactgtgtccactaatggcaacgacaaatcagcggaattacttgcactagcg
caagacatcgagtcattaaacagcagcaaaatcactttgataacagatgaaaatccatct
ggtcgtgcgccacaaatggccattagtcctaaaggcgaagcacctcgtgttcgctttgct
ggtatcccaatgggacacgaatttacgtctctagtacttgccttacttcaagccggtggc
cacccttcaaaagcggcgcaagacacactagagcaaattaaaggtttggacagcgaactg
aacttcgaggtgtacatttccctctcttgtcataactgcccagacgtcgtacaggccgtt
aacctaatggcggtccttaacccgaaaatcacggccaccatgatcgacggcgcactcttc
caaggcgaagtagacgagcgcaatatcatggccgtaccgtcggtttacctaaacggtgag
cactttggacaaggccgcatgaccttggacgagattctaaacaaggtcgacacgggggca
tcggataagcaagccgccgccttatccgaaaaagaagcttacgatgttttaatcgttggt
ggaggcccagcaggtgccgctgcggcaatctattcagcacgtaaaggcatacgtaccggt
gtggttgcagagcgctttggtggtcaagtatctgacaccatggccattgaaaactttatt
tcagtcaaagccaccgacggtcctaaattggtcgcagggttggaacaacacgttttagaa
tacgatgttgacctaatgaaaactcaaaaagccgttcgcttagaaaagaaagaatttgtc
gaagtagaactggaaaatggcgcgattcttaagagtaaatccgttgttctagccactggt
gcacgttggagagaaatgaacgtacccggcgaacaagagtaccgtggcaaaggcgtggct
tactgcccacactgtgacggcccattgttcaaaggtaagaaaacggcggttatcggtggt
ggtaactcgggaattgaagcggccattgacctagcgggtatcgtagaacatgtcactgtt
ctggaatttggtgacacactacgtgcagacgatgtattggtgaaaaaagcggaatcattg
ccaaacgtgtccatcattaaaaatgccatgacgaccgaagtattgggcgatgacgaacgc
gtcattggcttgaaatacacagatcgcaaaaccgacgagtctcacttggtcgatgtggca
ggtatcttcgtacagattggcttggtgccaaacagcgaattcctaaaagatacgctggaa
ctgaccaaccgaggagaaattgtggtgaacggacatggtgaaacctcattacccggtgtc
tttgccgctggggatgtgaccactgcaccttacaagcaaatcatcgtctccatggggtcc
ggagcaacggcagcacttggcgcatttgattacctaatccgccactaa

DBGET integrated database retrieval system