KEGG   Marinomonas posidonica: Mar181_1776Help
Entry
Mar181_1776       CDS       T01508                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mpc  Marinomonas posidonica
Brite
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mar181_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEF54814
UniProt: F6D0L6
LinkDB All DBs
Position
1922051..1922635
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHMSVETLEYHHGKHHNTYVVKLNGLVPGTEYEGKNLEEIIESA
PAGPVFNNAAQIWNHTFFWNSLSPNGGGQPTGALADAINAKWGSFEAFQEAFNDKAVNNF
GSSWTWLVKTASGELDIINTSNAGTPLTDGQTPLITVDLWEHAYYIDYRNVRPDYLKGFW
ALANWEFAAANFAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattgcccgcgcttccatacgcgaaagacgcactagagccacatatgtct
gtagagacattggaatatcaccatggtaagcaccataacacttatgttgttaagcttaac
ggtcttgttcctggcactgaatatgaaggcaaaaaccttgaggagatcattgagtcagct
cctgcaggtccagtctttaacaatgcggcacaaatctggaaccacactttcttctggaac
agcttaagcccaaatggtggcggtcagcctaccggcgcattagcggatgctattaatgct
aaatggggttctttcgaagccttccaagaagcgttcaacgacaaagccgttaacaacttt
ggttctagttggacttggttggttaaaaccgcttcaggcgagctagacatcatcaacact
agcaacgcaggcacaccattgactgacggccagactccgttaatcacggttgacctttgg
gaacatgcttattacatcgactaccgtaacgttcgtcctgattacctaaaaggtttctgg
gcgcttgcaaactgggaatttgcagcagcgaactttgccgcttaa

DBGET integrated database retrieval system