KEGG   Marinomonas posidonica: Mar181_2648Help
Entry
Mar181_2648       CDS       T01508                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00620  Pyruvate metabolism
mpc00680  Methane metabolism
mpc01100  Metabolic pathways
mpc01120  Microbial metabolism in diverse environments
mpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mar181_2648
  09102 Energy metabolism
   00680 Methane metabolism
    Mar181_2648
Enzymes [BR:mpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mar181_2648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEF55679
UniProt: F6CY47
LinkDB All DBs
Position
complement(2928421..2931051)
Genome map
AA seq 876 aa AA seqDB search
MSDRQASLRENVRLLGDCLGESMSNHLGEGFLEKVENIRLLSKDGRQSGDSAALIDALEA
LDDKEIVPVARAFNQFLNLSNIAEQYHRVHRRRTNESLGVYHNPVGDLLERLAKQNYTSE
QMIEALQGQSIELVLTAHPTEVVRRSLIRKYDNISSELEALDKDNILPLEETKHIRRLKE
IITQAWHTDEIREERPTPVDEAKWGFAVIEQSLWQAVPRFFRQLDEQFSEHSQQEHLPLD
LAPIRFATWMGGDRDGNPNVTHKVTKEVALLARWMAADLYIKDLNVLRSEFSMTQCNDAL
RARVGDSAQPYREVLRHLEMKMHKTKNWAKACLDGNPVSDEGVFLNSEELISDLVLCYQS
LLDSGMKVIANGSLLDLIRCAATFGMTLVRLDVRQDSARHIDTLSAITRFYGLGDYAEWD
EASRQAFLLAELNSKRPLLPLDWSPTDEVKEVLDTFAMIAQGDQSSFGSYVISMASAPSD
VLAVALMLKESGVSFPMRIVPLFETLADLDNAEPIIEQLLSMPWYKSYINGRQEVMIGYS
DSAKDAGQIAATWGQYRAQEALTRLCQKHGIHLTLFHGRGGTVGRGGGPAHVAILSQPPG
SVNGAIRVTEQGEMIRFKFGIPDIAVRSLELYCSAVMEATLIPAEPPKEEWRAIMDEMAE
VGMNQYRSIVRGHEDFVPYFRATTPEQELAKLPLGSRPARRRLDGGVESLRAIPWIFAWM
QIRLMLPAWLGAESAIEQGIESGNLDKLREMHEKWPFFGAYLDMLDMVLAKAEPEIAEYY
EKRLVPEELQGLGRLLRGKLSQVSDLVKKLKQQERLIEDNKTIRQSIDVRNPYIDPLHYL
QAELLFRSRRDEENAEVNKALMITMAGIASGMQNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatcgtcaggcgtcgttacgtgaaaatgttaggttgctgggagattgtctcggc
gagagcatgagtaatcacttgggagagggctttcttgaaaaagtcgaaaacattcgcctg
ctctctaaagatggtcgacaatctggggattcagccgcactcattgatgctctagaagcg
ttagatgataaagaaatagtccccgtcgctcgagcgtttaaccagttcctaaacctatct
aacattgcggagcaataccatcgagttcatcgacgtcgaaccaatgaaagtctgggtgtt
taccataacccagtaggggatttactcgagcgtttagcaaagcaaaattacacctcagag
caaatgatcgaagcgttacagggacagtctatcgagcttgtgttaacggctcaccctact
gaagtggtgcgacgttcattaattcgtaaatatgataatatttccagcgaattggaagcg
cttgataaagacaatatcctgccactggaagaaaccaaacacattcgtcgcctaaaagaa
atcattacccaagcttggcacacggatgagattcgtgaagagcgtccgacgccagtggat
gaggctaaatggggatttgcggtcattgagcagtctttgtggcaagctgttccacgcttt
tttcgccaactggacgagcagtttagtgagcattctcaacaggagcatttaccgttggac
ttggcgcctattcgctttgcaacttggatgggcggtgatcgggatggtaacccgaatgtg
actcataaggtcaccaaagaagtagccttgttagcccgctggatggcagccgatctttat
ataaaagacttaaatgttctgcgttcagagttttccatgacgcaatgcaatgacgcttta
cgagctcgagttggcgacagtgctcagccttatcgtgaagtgttgcgccatcttgaaatg
aaaatgcataaaactaaaaactgggctaaggcgtgtttggatggtaacccagtgtcagat
gagggtgtgtttctcaatagcgaagagttaattagtgatttggtgttgtgttaccagtct
cttttagacagcggaatgaaggtgatcgccaatggctcgttgcttgacttgattcgttgt
gccgccacgtttggtatgacattggtgcgtttggatgttcgtcaagattcggcgcgacac
attgacactttatcagccattactcgattttatgggcttggggattatgctgaatgggat
gaggcgtctcgtcaggcgttcttattggcggaattgaattctaagcgccctttgttaccg
ctggattggtcacccacagacgaagtgaaagaggtgttagatacctttgctatgatagcg
caaggagatcaaagttcgtttggttcctacgtgatttcaatggccagtgcaccttctgat
gtgttggcggttgctttgatgctgaaagagtctggggtgagcttccccatgcgaatcgtg
cccttatttgaaaccttggcggatttggataatgcggaacccattattgagcagctgctt
tccatgccttggtacaaatcctacataaacggtcgtcaagaagttatgatcggttattcc
gactctgctaaggatgctggtcaaattgcggctacttggggacaatatcgtgctcaggaa
gccctgacgcgactgtgtcagaagcatggcattcatctaaccttattccatggccgcggt
ggtactgtgggacgtggcggcggcccagctcatgtggcgattttatcgcagccacctggc
tcggtgaatggcgcgattcgagtcacagaacaaggtgaaatgattcgttttaaatttggt
attcctgacatcgcagtgcgctcgttagagctttattgttctgcggtcatggaggctact
ttgatacccgctgagccgccaaaagaagaatggcgtgccattatggatgaaatggctgaa
gttggcatgaatcaatatcgctcaattgttcgtggtcatgaagacttcgtaccttatttt
cgcgcgacgacgccggaacaggagttggcgaaattgcctctcggttcaagacctgctcga
cgtcgtttggatggtggcgtagaaagtttacgggcaattccatggatttttgcctggatg
caaattcgcctgatgttacctgcttggctaggggctgaaagcgcgattgagcaaggcata
gagtctggtaatttggacaagcttcgtgagatgcacgaaaaatggcctttttttggtgct
tatctagacatgctggatatggtcttagccaaagctgaacctgagattgcagaatactat
gaaaagcgtctggtgcctgaagagcttcaaggcttaggtagattgttacgaggcaagctt
agtcaagtcagtgatttggtgaagaaactgaaacagcaagagcgtttgatcgaagacaat
aaaaccatacgtcagtcgattgatgtgcggaatccttatattgacccattgcattatttg
caggctgagcttttgtttcgcagtcgtcgtgatgaagaaaatgcagaagtgaataaagcc
ttgatgattaccatggcaggcattgccagcggtatgcaaaatacaggctaa

DBGET integrated database retrieval system