KEGG   Marinomonas posidonica: Mar181_3217Help
Entry
Mar181_3217       CDS       T01508                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01130  Biosynthesis of antibiotics
mpc01230  Biosynthesis of amino acids
Module
mpc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mpc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mar181_3217
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Mar181_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA TsaE Cytidylate_kin2 AAA_16 AAA_23 AAA_33 RuvB_N Cytidylate_kin AAA_5 ABC_tran Zeta_toxin dNK AAA_22 SRPRB CHDNT
Motif
Other DBs
NCBI-ProteinID: AEF56240
UniProt: F6CT74
LinkDB All DBs
Position
complement(3538729..3539304)
Genome map
AA seq 191 aa AA seqDB search
MINAPNIILVGPMGAGKTTIGRLISQSMGKEFYDLDKVIEDNAGADIPWIFEREGEEGFR
KRETQALSNMVQSDTHNTVLATGGGIVTRSENRDILQQDGLVVYLYASVAQQLYRTSKSS
HRPLLQAGDPKATLKKLFEVRDPLYREVATLVIETDARHPKAVANKVLEAIKRYLTSEDS
NPNAHLNRGSW
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcccccaatattattttagtaggcccaatgggcgctggaaaaacaacgata
ggccgtttgatttcacaatcgatgggcaaagagttttacgatctagacaaagtcatagaa
gacaatgccggtgccgatataccatggatttttgagcgcgaaggggaagagggatttcgt
aaaagagaaacgcaagcgctttcaaacatggttcagtcagatacacacaatactgtccta
gcgacgggtggtggtattgttacacgatcagagaatcgtgatattttgcagcaagatggt
ttagtggtgtacctatatgcttcggtagcgcagcagctttatcgaacctcgaagagttct
catcgacctttgttgcaagcgggtgaccccaaagcaacgttgaaaaaattattcgaagtg
cgtgaccctctttatcgagaggtggcgaccttagtcattgaaaccgatgcccgtcatccc
aaagccgtcgctaataaagtattagaagccatcaagcgttatttaacatcggaggacagc
aatcctaatgcgcaccttaaccgtggatcttggtga

DBGET integrated database retrieval system