KEGG   Methanocella paludicola: MCP_0620Help
Entry
MCP_0620          CDS       T01142                                 

Gene name
trxB-1
Definition
(GenBank) putative thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpd  Methanocella paludicola
Brite
KEGG Orthology (KO) [BR:mpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MCP_0620 (trxB-1)
Enzymes [BR:mpd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MCP_0620 (trxB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like K_oxygenase FAD_binding_2 FAD_oxidored NAD_binding_8 NAD_binding_9 Lycopene_cycl Thi4 NAD_binding_7 DAO Sirohm_synth_M AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAI60692
NITE: MCP_0620
UniProt: D1YW70
LinkDB All DBs
Position
600436..601353
Genome map
AA seq 305 aa AA seqDB search
MMALLDLIIIGAGPAGMTAAIYAKRKGLTLQVLADSVGGQVTKTGNVENYPGYKSIPGPQ
LAALIKKQLEEMTVDITMSRAAKLEKSGDYFKVTSGDGHTYEARAVIIASGSKWKELNVP
GEKEFKNRGVSYCPTCDGPLFSGMDVAVIGGGNAAAEAVLDLIPLATKVYLVVRSTLKAD
KVVIDKISANDKVTILTGYTVDKINGTDFVESVDIVSTGGERKTLSVGGVFVEVGLAPNV
AFAKDLVQLNDRGEIVIDERCRTSVCGVYAAGDVSDVPQKQIIVAAGEGAKAAMSAFTYI
STQKC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgatggctttactcgacctcatcatcattggcgccggccctgcgggcatgacggcggcc
atttacgcgaaacggaaggggcttactttacaggtgctggccgactccgtcggcggccag
gtcacaaagaccggcaacgtggagaactatccgggctataagagcataccggggccccag
ctggcggccctcatcaagaaacagctcgaggagatgacggtggacattacgatgagccgc
gcggcgaagctcgaaaagtccggcgattattttaaagtgacgtccggggacggccatacg
tacgaggcgagggccgtcatcattgcgtcgggctcgaagtggaaagagctgaacgtcccg
ggcgagaaggaatttaagaaccggggcgtgagctattgtccgacgtgcgacggccccctg
ttctcgggcatggacgtagcggtcatcggcggcgggaacgcggctgctgaggcggtgctc
gacctcatacccctggcaacgaaggtatacctggtcgtccggagcaccctgaaggcggat
aaggtcgtcatcgataagatatcggcgaacgataaggtgacaatccttaccgggtacacg
gtcgataagatcaacggcacggatttcgtggaatcggtggatatcgtttccacgggcggc
gagcgtaagacgctcagcgtgggcggcgtgttcgtcgaggtcgggctggcgcccaacgtg
gccttcgccaaagacctggtgcagctcaacgacaggggcgagatcgtgatcgacgagcgc
tgccggaccagcgtttgtggcgtctatgcggccggcgacgtgagcgatgtgccccagaag
cagatcatcgtggcagccggcgagggtgcaaaggcagccatgtcggcgttcacctatatc
agcacgcagaagtgctag

DBGET integrated database retrieval system