KEGG   Mesotoga prima: Theba_0785Help
Entry
Theba_0785        CDS       T02123                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mpg  Mesotoga prima
Pathway
mpg00500  Starch and sucrose metabolism
mpg01100  Metabolic pathways
mpg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Theba_0785
Enzymes [BR:mpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Theba_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase DUF3416
Motif
Other DBs
NCBI-ProteinID: AFK06499
UniProt: I2F3J6
LinkDB All DBs
Position
complement(830694..833261)
Genome map
AA seq 855 aa AA seqDB search
MYFLERVMAVPRLPEKLRRLEELSKNLWWSWNYRAQQMFKYMDPEMWYQERRSPIRLLRR
ISQTRLYELSEDKPFIEMYESVVGEFDEYMGGKDTWMDREHPDRKEQCIAYFCAEYGFHE
SFPIYSGGLGILAGDHLKTASDMGLNFVAVGLLYRNGYFEQRIDESGWQQNIYHSYEFED
FPVVPAQDDSGDEIFVNIDFPGRKVWAKIWKTAVGRTSLYLLDTDIPQNEPEDRNITATL
YGGDRETRIKQEILLGIGGVRALRMLNYSPNVWHMNEGHAAFLSLERIRELVQKNSIDLS
TASMIVKSGNVFTTHTPVPAGNDTFSLEIIDKYFRDFWSTIRAERDEFINLGIERLPGGG
QQYSMTVLALRLSALANGVSKLHGRVSRNLWNHIYPDLPAVEVPISHVTNGVHIWTWLNP
DLVKLLDRYLPVGWHEKVYDPEIWEAVDKIPEEEIWKLHMSLKSRARNFLQGRLKRQRMR
LGETIEDLMEVEEALPEDVLTIGFARRFATYKRATLIFKDINRLKSIITNSERPVQFVFA
GKAHPADDPGKELIRKLYEISRTPEFKSRIIIVENYDMNIARHLVSGVDVWLNTPRRPHE
ASGTSGEKAGMNGVLNFSVLDGWWVEGFNGVNGWAIGDNRDYKDHELQDRIDSVSIYSSL
EKEIIPLYYSRDEKGVAKEWAKRMKNSIKEIGSKFNTHRMIADYAEDLYFPVADLSKEVE
KDDFKLAKSVAIWKDKFSSSWNAIRIKPNMIGETSAKSVKVGQEISVSANIYLGTMDPSE
VQVEIFVAKMNDEGEMDGFSLYPMKLVKEDVHGEYVYGGKFTVAEEGQLAYTVRVIPNPE
RLPHRYFIPVAKWIT
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcctcgaaagagtgatggcagtaccacgattaccggagaagctaagaagactt
gaagaactttcaaagaacctttggtggagttggaactaccgcgctcaacagatgttcaaa
tacatggatccagaaatgtggtatcaggaaagaaggagtcccataaggcttcttcgaagg
ataagtcaaaccagactttatgagctttccgaagacaaaccatttattgagatgtatgaa
agtgttgtaggagagtttgatgaatatatgggtgggaaagatacctggatggatagagaa
catccggacagaaaggaacaatgtatcgcgtatttctgtgccgaatatggcttccatgaa
tctttcccgatctactccgggggtcttgggattcttgctggagatcacttgaagactgcc
agtgatatgggactgaacttcgttgccgtcggtcttttatacaggaacggttatttcgaa
cagagaatcgacgagtcgggctggcaacagaacatataccactcttatgaatttgaagac
ttccccgtagttcccgcacaggatgactcgggagatgagatatttgttaacatcgacttt
ccaggcaggaaagtctgggcgaaaatctggaagacagccgtgggaagaacatctctctat
ctacttgatacagacattccccaaaacgagccggaagacagaaacataactgctacactc
tatggcggtgaccgggaaactaggataaaacaagagattctccttggcatcggcggagtg
agggctctcagaatgctcaattattcgccgaatgtttggcacatgaatgaagggcatgcg
gccttcctttctctcgagagaatcagagagctggttcagaagaattcgatagatttatcc
acagcttcaatgattgtcaaatcaggcaacgtctttaccactcacactcctgtgcccgcc
ggaaatgacacgttcagcctcgagataatcgacaaatacttccgcgatttctggagcaca
ataagagccgagagagatgaattcataaatctcgggattgaaagacttccgggcggaggc
cagcaatacagtatgaccgttctagcccttagattgtccgctctagctaatggagtcagc
aaacttcacggaagggtaagcagaaacctttggaatcatatctaccccgacctgccggct
gtcgaggtcccaatatctcatgttacaaacggagtacatatctggacctggctgaaccca
gatctggtcaaacttcttgacagatatttgcctgtcggttggcacgaaaaagtgtacgac
cccgaaatctgggaggcagtggacaaaatacccgaagaggagatctggaaattgcatatg
tcgctaaaatccagggccagaaactttctccaaggtaggctcaagaggcaaagaatgaga
cttggcgaaaccattgaagatcttatggaagtcgaagaagctcttcccgaggatgttctt
acgattggattcgcaaggagatttgccacatataagagggcgacgttaattttcaaggat
atcaacaggctgaagtcgataataacgaactctgaaagaccggttcagtttgtctttgcc
gggaaggctcatcctgcagacgaccctggaaaggaactgataagaaagctttatgaaatt
tccaggactcctgaattcaaaagtcgaatcattatagtcgaaaattacgacatgaacata
gctcgacacttggtgagcggtgtcgatgtatggctcaatacaccgagaagacctcatgaa
gctagtggaaccagtggtgagaaggctggtatgaatggagttctgaatttcagtgttcta
gacggctggtgggtagaaggcttcaacggagtaaacggctgggccatcggcgacaataga
gattacaaggaccacgagcttcaggatagaattgattccgtttccatttacagctcactt
gaaaaggagataattcccctttactactctagagacgaaaagggagttgccaaagagtgg
gcaaagagaatgaaaaactctatcaaagaaatcggaagcaaattcaatactcacaggatg
atcgcagactatgctgaggatctatatttcccagtcgccgatctttccaaagaagtcgaa
aaagatgatttcaaactcgcgaagagtgttgccatctggaaagacaaattcagttcaagc
tggaatgccataagaatcaagcccaatatgataggtgagacttctgcaaagtccgttaag
gtaggacaggagatttctgtttcagcgaacatatatctcggtactatggatccttctgag
gttcaggtcgagatcttcgtggcaaagatgaatgacgaaggagaaatggacgggtttagt
ctttaccccatgaagttagttaaggaagatgttcacggcgaatatgtctatggaggcaaa
ttcaccgtagctgaagaagggcagcttgcatacactgttagagtaattcccaaccccgaa
agactacctcacagatacttcatacctgttgcaaaatggattacgtag

DBGET integrated database retrieval system