KEGG   Microlunatus phosphovorus: MLP_12030Help
Entry
MLP_12030         CDS       T01535                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00473  D-Alanine metabolism
mph01100  Metabolic pathways
mph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MLP_12030 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MLP_12030 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mph01011]
    MLP_12030 (alr)
Enzymes [BR:mph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MLP_12030 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mph01011]
 Precursor biosynthesis
  Racemase
   MLP_12030 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C MOZART2
Motif
Other DBs
NCBI-ProteinID: BAK34217
UniProt: F5XNV3
LinkDB All DBs
Position
1318003..1319208
Genome map
AA seq 401 aa AA seqDB search
MSPYIDPSTASAVIDLDAFAANIETLRAHVAPAAVMVVVKADAYGHGLLECARAARDAGA
DWLGVATPGEALALRAAGDRGLLLAWLYGPQEDLTPLLAAEVDVSAQSVDQLDRIAAGAR
AVGRRARVHLKIDTGLSRNGATAAEWPAICAGARCAEQAGVVEVVGVWSHLASADEPGAV
SVGAQQEAFENAYRVALQAGLQPAIRHLANSAGAMIWPETRYDLVRLGIATYGIEPDAGI
ADLAGISLRPVMRLRAQLVNVKAVATGAGVSYGHTWHAPAPATLGLVPLGYGDGIPRRAG
NRAEVGWRGRRAPIRGRVCMDQFVVELVDRQLSAASPVVEVGEEVTLFGPGDHGEPTAAE
WAGWCDTIGYEIVTRIGSRVPRVYLRRSASGDSAAAEGEGG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgtacatcgatccgtcgaccgcgtcggcagtgatcgacctggacgccttcgcc
gccaacatcgagaccctgcgagcccacgtggccccggctgcggtgatggtggtcgtgaaa
gcagacgcgtacggccatggcctcctggagtgtgcgcgggcggcccgggacgccggcgcg
gactggctcggcgtggcgaccccgggtgaggcgctggcgctgcgcgcggccggtgaccgg
ggcctcctgttggcctggctgtacggaccgcaggaggatctgactccgttgctcgccgcc
gaggtggatgtctcggcgcaatcggtcgatcaactcgaccggatcgcggctggggcgcgg
gcggtggggcggcgggccagggtgcatctcaagatcgacaccgggctgtcccgcaacggt
gccaccgccgcggagtggccggcgatctgtgccggggcccgatgcgcggagcaggccggc
gtcgtcgaggtcgtcggggtctggtcacatctggccagcgccgatgagcccggtgcggtg
tcagttggtgcgcagcaggaggcgttcgagaacgcgtaccgtgtggcgctccaggcgggg
ctgcagccggcgatcaggcacctggcaaactcggccggcgcgatgatctggcccgagaca
cgctatgacctggtgcggctcgggatcgccacgtacgggatcgagccggacgccgggatc
gccgacctggcaggaatatcgctgcggccggtgatgcggctgcgagctcagctggtgaac
gtcaaggcggtcgcgacgggcgcgggggtgtcgtacgggcacacctggcacgcgccggct
ccggccacgctgggactggtgcccttgggctacggcgacgggatcccgcggcgggccggc
aaccgtgccgaggtcggctggcgcggtcgccgggcacccatccgtggccgggtctgcatg
gaccagttcgtggtcgagctcgttgatcggcagttgtccgcagcaagcccggtcgtggag
gtcggggaagaagtcaccctgttcggccctggcgatcacggtgagccgaccgccgccgag
tgggccggttggtgcgacacgatcggctatgagatcgtcacccggatcggttcccgggtg
cctcgggtctatcttcgccggtcagcatcgggcgactcggcagcagcggagggtgagggt
ggctaa

DBGET integrated database retrieval system