KEGG   Microlunatus phosphovorus: MLP_12700Help
Entry
MLP_12700         CDS       T01535                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00020  Citrate cycle (TCA cycle)
mph00270  Cysteine and methionine metabolism
mph00620  Pyruvate metabolism
mph00630  Glyoxylate and dicarboxylate metabolism
mph00680  Methane metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
Module
mph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mph_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_12700 (mdh)
   00620 Pyruvate metabolism
    MLP_12700 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    MLP_12700 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    MLP_12700 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MLP_12700 (mdh)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     MLP_12700 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: BAK34284
UniProt: F5XPH6
LinkDB All DBs
Position
complement(1391465..1392454)
Genome map
AA seq 329 aa AA seqDB search
MSTPVKVAVTGAAGQIGYSLLFRIASGSLLGPDTPVQLRLLEITPALKALEGVVMELDDC
AFPLLAGVETGDDPNVVFDGANIALLVGARPRTKGMERGDLLEANGAIFKPQGAALNAHA
ADDIKVLVTGNPANTNALIAKSNAPDIPAERFNALTRLDHNRALAQLAAKTGSTVNDITK
MTIWGNHSATQYPDVFHSEVNGRNAAELIDDQDWLESTFIPTVQQRGAAIIAARGASSAA
SAANATVDHMRDWVLGTPEGDWVSMAVPSDGSYGIAEGIITSFPCTTAGGAYNIVQGLEL
NEFSRAKIDASVAELQGEREAVQALGLVE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacacccgtcaaggtcgccgtcaccggagcagccggtcagatcggctacagcctg
ctgttccgcatcgccagcggatcgctgctgggtcctgacaccccggtgcagctgcggctg
ctggagatcaccccggccctgaaggcactcgaaggtgtcgtaatggagctcgacgactgt
gccttcccattgctcgcaggggtggagaccggcgacgatcccaatgtggtcttcgacggc
gccaacatcgcgctgctggtcggcgcccgaccacggaccaagggcatggagcggggcgat
ctgctggaggccaacggcgcgatcttcaagccgcagggcgccgcgctgaacgcgcatgcc
gccgacgacatcaaggtgctggtcaccggcaatccggccaacaccaacgccctgatcgcc
aagagcaatgcacccgacatccccgcggaacggttcaacgcgctcacccgattggaccac
aaccgggcccttgcccaactggctgccaagaccggcagcaccgtcaacgacatcaccaag
atgacgatctggggcaaccattcggccacgcagtacccggacgtcttccactccgaggtg
aacggccggaacgccgcggaactgatcgacgatcaggactggctggagtcgaccttcatc
ccgaccgtgcagcagcgtggcgccgcaatcatcgcggctcgcggcgccagctctgcggcc
agcgcggcgaacgccaccgtcgaccacatgcgtgactgggtgctgggcacccccgagggc
gactgggtgtcgatggcggtgccgtccgacggctcgtacgggatcgcggaagggatcatc
accagcttcccctgcaccacggccggcggcgcctacaacatcgttcaggggttggagctc
aacgagttctctcgcgccaagatcgacgccagtgtcgccgagctgcaaggcgagcgggag
gccgtgcaggccctcggcctggtcgagtga

DBGET integrated database retrieval system