KEGG   Microlunatus phosphovorus: MLP_14460Help
Entry
MLP_14460         CDS       T01535                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mph  Microlunatus phosphovorus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: BAK34460
UniProt: F5XQG0
LinkDB All DBs
Position
complement(1577520..1578611)
Genome map
AA seq 363 aa AA seqDB search
MVGVDLPVMPPVKPMLAKSVPTIPTGDLSYEPKWDGFRSIVFRDGDEVEIGSRNERPMTR
YFPELVEALRANLPQKCVLDGEIVVVRGDRLEFEVLQQRIHPAASRIKLLSEQTPATFVA
FDLLALGDEDYLQRPFAERRAALEQALASAEAPIHVTPTTRDPAIAQNWFEQFEGAGLDG
VVAKPLAGTYQPDKRTMFKIKHQRTADCVVAGYRVHKSGPDTIGSLLLGLYNDDGVLTSV
GVIGAFPAARRKELFTELQPLVTTFDDHPWAWAKEEVGTRTPQHSAGSRWNNGKDLSFVP
LRPDLVVEVRYEHMEGVRFRHTAQFNRWRPDREPRSCTYEQLEEPVSYDLADILGLVSDS
PEQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgtggaccttccggtgatgccgcccgtcaaaccgatgctggccaagtcagtg
ccgacgatccccaccggggatttgtcgtacgagcccaagtgggacgggttccgctcgatc
gtcttccgcgacggggacgaggtggagatcggctctcgcaacgagcggccgatgactcgc
tacttccctgagctggtcgaggctttgcgggcaaacctgccgcagaagtgcgtgctggac
ggcgagatcgtcgtcgtccgtggcgaccggctggagttcgaggtgctgcaacaacggatc
catcccgcggccagccggatcaaactcttgtccgagcagacaccggccaccttcgtggcg
ttcgatctgctggcgctcggcgacgaggactacctccagcgaccgttcgcggagcgacgg
gcggcactggagcaggcgctggccagcgccgaggcgcctattcacgtcacgccgaccacg
cgcgacccggccatcgcgcagaactggttcgagcagttcgagggcgccggactcgacggt
gtggtcgccaagccgttggccgggacctaccagccggacaagcggaccatgttcaagatc
aagcaccagcgcacggccgactgcgtggtggccggctatcgagtacacaagagcggtccc
gacacgatcggctcgctgctcctgggtctctacaacgacgacggcgtgctcacctcggtc
ggcgtgatcggcgcctttccggcagcccggcgcaaggagctcttcaccgagttgcagccg
ctggtcaccaccttcgacgaccatccgtgggcctgggcgaaggaggaagtgggcacccgg
acaccgcagcactccgccggcagccggtggaacaacggcaaggatctctccttcgtgccg
ttgcgacctgacctggtggtcgaggtgcgctacgagcacatggagggggtccggttccgg
cacaccgcccagttcaatcgttggcgtccggaccgcgagccacggtcgtgtacgtacgag
cagttggaagagccggtcagctatgaccttgccgacatcctcggactcgtgtcggactcg
ccggagcagtga

DBGET integrated database retrieval system