KEGG   Microlunatus phosphovorus: MLP_16560Help
Entry
MLP_16560         CDS       T01535                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00020  Citrate cycle (TCA cycle)
mph00190  Oxidative phosphorylation
mph00650  Butanoate metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
Module
mph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_16560 (sdhA)
   00650 Butanoate metabolism
    MLP_16560 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MLP_16560 (sdhA)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MLP_16560 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MLP_16560 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_3 GIDA AlaDh_PNT_C GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: BAK34670
UniProt: F5XRI0
LinkDB All DBs
Position
1785096..1787063
Genome map
AA seq 655 aa AA seqDB search
MSDTINSVDADSLYVDGPDIGDTKAPAGPIEERWDKRRFGAKLVNPANRRKLNVIIVGTG
LAGASAAATLGEAGYQVTSFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIYRLFYDTVK
GGDFRSRESNVYRLAQVSVEIIDQCVAQGVPFARDYAGLLDNRSFGGVQVSRTFYARGQT
GQQLLIGAYQALERQIAAGTVTMNTRHEMLELIVADGRARGVVVRDMVTGEIETHFADAV
VLCTGGYGNVFFLSTNAMGCNVTATWRAHRKGAYFGNPCYTQIHPTCIPVTGEYQSKLTL
MSESLRNDGRIWVPKSGEDKRDPRQIPESDRDYYLERIYPAFGNLVPRDIASRAAKYVCD
EGRGVGPGGLGVYLDFADAIKRLGRPAVEAKYGNLFDMYAQITGENPYETPMRIYPAVHY
TMGGLWVDYDLQSSITGLYVAGEANFSDHGANRLGASALMQGLADGYFVLPNTINDYLAA
GPFEKIDASHPAAVEAVEAVKSRIDKLLSINGNRTVDSFHKELGRVMWEYCGMERTEEGL
RKAITRIRELKAEFWADVKVLGTNDELNQALERAGRVADFFELGELMCIDALVRRESCGG
HFRAESQTEDGEALRHDDEFAYVSAWEFGGDGGKPILHKEPLEYEYVEMKQRSYK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacacgatcaactcggtcgacgcggactcgctctacgtcgacggcccggacatc
ggcgacaccaaggcgccggccggcccgatcgaggagcgctgggacaagcgtcgcttcggc
gccaagctggtcaacccggccaatcgccgcaaactcaacgtgatcatcgtcggcaccgga
ctggccggggcctcggcggccgcgacgctcggtgaggccggctatcaggtgaccagcttc
tgctatcaggactccccgcgccgggcgcactcgatcgctgcccagggcggcatcaacgcc
gccaagaactaccgcaacgacggcgactccatctaccgactcttctacgacaccgtgaag
ggcggcgacttccggtcccgggagtccaacgtctaccggctggctcaggtcagcgtggag
atcatcgaccagtgcgtcgctcaaggcgtcccgttcgctcgggattacgccgggctgctc
gacaatcgatccttcggcggcgtacaggtctctcgtaccttctatgcgcgcggccagacc
gggcagcagttgctgatcggcgcctatcaggcgctggagcggcagatcgcggccggcacg
gtgaccatgaacacccggcacgagatgctcgagctgatcgtggccgacgggcgggcccgt
ggtgtggtcgttcgggacatggtcaccggcgagatcgagacccacttcgccgacgcggtg
gtgctgtgcaccggcggctacggcaacgtgttcttcctgtccaccaatgcgatgggctgc
aatgtgaccgccacgtggcgggcccaccgcaagggcgcgtacttcggcaacccgtgctac
acccagatccatccgacctgcatcccggtcaccggcgagtatcagtccaagctcaccttg
atgagcgagtcgttgcgcaacgacggccggatctgggtgccgaagtcgggggaggacaag
cgcgatccgcgccagatcccggagtccgaccgcgactattacctggagcggatctacccg
gccttcggcaacctggtgccgcgcgacatcgcttctcgagccgcgaagtacgtctgcgac
gagggtcgtggtgtcggtcccggcggtctgggcgtctatctggacttcgccgacgcgatc
aagcggctgggccgcccggcggtcgaggcgaagtacggcaacctgttcgacatgtacgcc
cagatcaccggcgagaacccgtacgagacgccgatgcggatctatccggccgtgcactac
acgatgggcgggttgtgggtggactacgacctgcagtcctcgatcaccggcctgtacgtg
gcgggggaggccaacttctccgaccacggtgccaaccggctcggcgcgtcggccctgatg
caagggctggccgacggctacttcgtgctgccgaacacgatcaacgactacctggccgcc
gggccgttcgagaagatcgacgcgtcccacccggccgcggtcgaggccgtcgaggcggtc
aagtcccggatcgacaagctgctgtcgatcaatggcaaccgtacggtcgactccttccac
aaggaactcggtcgggtgatgtgggaatactgcgggatggagcggaccgaggagggtctg
cgcaaggcgatcacgcggatccgtgagttgaaggcggagttctgggccgacgtgaaggtg
ctcggcaccaacgacgagctcaatcaggcgctggagcgggccgggcgggtggccgacttc
ttcgagctcggtgagctgatgtgcatcgacgccctggtccggcgggaatcctgcggcggc
cacttccgggccgagtcgcagaccgaggacggcgaggcgctgcggcacgacgacgagttc
gcgtacgtgtcggcctgggagttcggcggcgacggcggcaagccgatcctgcacaaggag
ccgctggagtacgagtacgtcgagatgaagcagcggagctacaagtga

DBGET integrated database retrieval system