KEGG   Microlunatus phosphovorus: MLP_16570Help
Entry
MLP_16570         CDS       T01535                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00020  Citrate cycle (TCA cycle)
mph00190  Oxidative phosphorylation
mph00650  Butanoate metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
Module
mph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_16570 (sdhB)
   00650 Butanoate metabolism
    MLP_16570 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MLP_16570 (sdhB)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MLP_16570 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MLP_16570 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_10 Fer4_9 Fer4_2 Fer4 Fer4_6 Fer4_18 Fer4_4 Fer4_22 Fer4_21 Fer2 Fer4_3 Fer4_15 Fer4_13 Fer4_16
Motif
Other DBs
NCBI-ProteinID: BAK34671
UniProt: F5XRI1
LinkDB All DBs
Position
1787332..1788090
Genome map
AA seq 252 aa AA seqDB search
MNITVRVWRQSGPEASGKMVSYDVPDVSEHMSFLEMLDVLNERLTLKGEDPIAFDSDCRE
GICGMCGVVINGIPHGRGESPVQTTTCQLHMRSFTDGAVIDIEPWRADPFPVIKDLVVDR
GAFDRIIQAGGFISVPTGSAAEANAAPVPKAAADHAFDAATCIGCGACVAACPNGSAMLF
TAAKITHLGLLPQGQPERKSRVVGMVHTHDEEGFGACTNIGECTAVCPKGIPLETISRLN
RDLLGAMVNPQT
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcactgtgcgggtttggcggcagtctgggccggaggcgtccgggaagatggtc
tcctacgacgtgcccgacgtgagcgagcacatgtcgttcctggagatgctcgacgtgctg
aacgagcggctcactttgaagggcgaggacccgatcgcgttcgacagcgactgtcgtgag
gggatctgcggcatgtgcggcgtggtgatcaacggcatcccccacggtcgcggcgagtca
ccggtgcagaccaccacctgccagctgcacatgcgctccttcaccgatggtgcggtgatc
gacatcgagccgtggcgagccgacccgttcccggtgatcaaggacttggtggtcgaccgc
ggcgcgttcgaccggatcatccaggccggcggcttcatctcggtcccgaccggcagcgcc
gctgaggccaatgcggcgccggtgcccaaggcggccgccgaccatgccttcgacgctgcc
acctgcatcggctgcggggcctgcgtcgcggcctgcccgaacggctcggcgatgctgttc
accgccgccaagatcacccacctggggctgctgccgcagggccagccggagcgcaagtcc
cgggtggtcggcatggtgcacacccatgacgaggagggcttcggcgcctgcaccaacatc
ggcgagtgcactgccgtctgcccgaagggcatccccctggagacgatctcccggctcaac
cgggacctgctcggcgcgatggtgaacccgcagacctga

DBGET integrated database retrieval system