KEGG   Microlunatus phosphovorus: MLP_19140Help
Entry
MLP_19140         CDS       T01535                                 

Definition
(GenBank) putative L-amino acid oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00260  Glycine, serine and threonine metabolism
mph00330  Arginine and proline metabolism
mph00340  Histidine metabolism
mph00350  Tyrosine metabolism
mph00360  Phenylalanine metabolism
mph00380  Tryptophan metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_19140
   00330 Arginine and proline metabolism
    MLP_19140
   00340 Histidine metabolism
    MLP_19140
   00350 Tyrosine metabolism
    MLP_19140
   00360 Phenylalanine metabolism
    MLP_19140
   00380 Tryptophan metabolism
    MLP_19140
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     MLP_19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 HI0933_like Thi4 FAD_oxidored GIDA Pyr_redox TAT_signal Glu_dehyd_C 3HCDH_N AlaDh_PNT_C Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: BAK34928
UniProt: F5XT56
LinkDB All DBs
Position
complement(2048041..2049507)
Genome map
AA seq 488 aa AA seqDB search
MTRGLDRRTFLGALAAGAALPLAGQLPTPAQAEPTDRRRKCIAVLGAGLAGLAAAYQLTR
RGYEVIVLEAQDRPGGRVETVRDGFRRGGHAEMGAVRIFETHTYTQKYVREFGLTLSPYD
EGPSAVHLRGRRFLPPADGQPWPIPGLHPSEQPDPAARFPDYVEPGFDELGDLDTPGWPG
SVPSARRLDRHTMDGYLRRRGASLAWRDWFYAQNGRIARVNAAAGFAVESLQSGERLTSI
QGGNDRLPYAMAAALGSRVKYGSEVVRIAQDRHGVTIGYRDRTGGHELQVDRCVCALPFA
PLRNVRLDAGFSQRKHRAIRNLAYMPAARCYFQTHSRFWEHDPLGRLGGLDLVGTDTMAG
RVWNTSSQQRQPGLGMLHAYMFDTEALTFAAHGPGRVQAMRRLLDRVLPGLTEQVVAVAH
KAWQEDRWASDGWGWTPSGDLHWMLPAMQQPEGRIHFAGEHTSLWIAWMNGALESAERVV
EEIHHADS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtggactggatcgacggaccttcctcggtgccctcgcggccggggcagcgctg
ccgttggccggacagctgcccacgccggcgcaggccgagcccaccgatcgccgacggaaa
tgcatcgccgtcctgggtgccggactcgccggtctggccgcggcgtatcagctgaccagg
cggggatacgaggtgatcgtgctcgaggcccaggaccggccgggcggacgcgtcgagacc
gtgcgcgacggcttccgtcgtggcggacacgccgagatgggggcggtgcgcatcttcgag
acccacacctacacccagaagtacgtccgcgaattcggtctgacgctgtcgccctacgac
gaggggcccagcgccgtccacctccgcggccggcgcttcctgccacccgcggacgggcag
ccctggccgatccccggcctgcatccctccgagcagccggacccggctgcccggttcccc
gactacgtggaacccgggttcgacgagctcggcgatctggacactcccggctggccgggc
agcgtgccctcggcgcgccgactcgaccggcacaccatggacggctatctgcgacgacgc
ggcgcctcactggcgtggcgggactggttctatgcgcagaacggacgcatcgcccgggtc
aacgccgccgccggcttcgccgtggagtcgctgcagagcggggagcggctcaccagcatc
cagggcggcaacgaccggctcccgtacgccatggccgccgccctcgggagccgcgtcaag
tacggcagcgaggtcgtccggatcgcccaggatcgccacggcgtcacgatcggctaccgg
gaccggaccggcggccacgaactgcaggtggaccgctgcgtgtgcgccctgccgttcgca
ccgctgcgcaacgtacgcctcgacgccggtttctcgcagcggaagcaccgcgccatccgc
aacctcgcctacatgccggctgcccgctgctatttccagacccacagccggttctgggaa
cacgatccgctcggtcgactcggcgggctcgacctggtcggcaccgacaccatggccggt
cgggtctggaacaccagctcccagcagcggcagccgggtctcgggatgctgcatgcctac
atgttcgacaccgaggcgttgaccttcgccgcccacggcccgggccgggtgcaggccatg
cgtcgtcttctcgatcgcgtactgcccgggctgaccgagcaggtggtcgccgtcgcccac
aaggcgtggcaggaggaccgttgggccagcgacggctggggctggacaccatccggcgac
ctgcactggatgttgcccgccatgcagcaaccggagggtcgcatccacttcgccggcgag
cacacgtccttgtggatcgcctggatgaacggcgctctggagtctgccgaacgcgtcgtg
gaggagattcaccatgccgattcgtga

DBGET integrated database retrieval system