KEGG   Microlunatus phosphovorus: MLP_53380Help
Entry
MLP_53380         CDS       T01535                                 

Gene name
ddl2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00473  D-Alanine metabolism
mph00550  Peptidoglycan biosynthesis
mph01100  Metabolic pathways
mph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MLP_53380 (ddl2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MLP_53380 (ddl2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MLP_53380 (ddl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mph01011]
    MLP_53380 (ddl2)
Enzymes [BR:mph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MLP_53380 (ddl2)
Peptidoglycan biosynthesis and degradation proteins [BR:mph01011]
 Precursor biosynthesis
  Amino acid ligase
   MLP_53380 (ddl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAK38352
UniProt: F5XIW4
LinkDB All DBs
Position
5662461..5663453
Genome map
AA seq 330 aa AA seqDB search
MTLSSQPITETAVVLSGGLSHERDVSLRSGRRVAMALRSRGVEVIESDVDSNLIGLLDSL
PQAVVFPVLHGEAGEDGALREVLSLLGVPFVGSVGAACRVAFDKSIATTVVAESGVATPT
QIALPHEIFRELGAQALMAALADQIGFPMMVKPSRSGSALGASKVTRPEELPSAMVGAYA
YGSVAVIEQFVSGVEVTVTVADRGDGPKALPAVEIRPDSGVYDYAARYTAGATRFLCPAE
LDPAVAEACASVALRVHDVLGLRDLSRTDLIVTPDGVPTFLEVNVAPGMTETSAVPLAVE
SAGWSLGKMCADLIRVAARRGGRVPAEPVA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcagcagccagccgatcacagagaccgccgtcgtgctgtccggtggcctgtcc
cacgagcgcgacgtgtcgttgcggtcgggccgccgggtcgccatggccctgcgctcgcgg
ggagtcgaggtgatcgagtccgatgtcgactcgaatctgatcggcctgctcgactcgctg
ccccaggcggtggtgttccccgtgctgcacggcgaagccggcgaggacggcgccttacgg
gaagtgctgtcgctgctcggggtgcccttcgtcggctcggtcggcgccgcctgccgggtc
gctttcgacaagtcgatcgccaccacggtggtagccgagagcggcgtggccactcccact
cagatcgcgctgccgcacgagatcttccgcgagctcggtgcccaggccctgatggcggca
ctcgccgaccagatcgggttcccgatgatggtcaagccgtcgcggagcggctcggcactc
ggtgccagcaaggtcacccggcccgaggagctgccctcggcgatggtgggcgcgtacgcg
tacggctcggtggccgtgatcgagcagttcgtgtccggcgtggaggtcacggtcacggtc
gccgaccgaggcgacggtccgaaggcgctgcccgccgtggagatccggccggactcgggc
gtgtatgactacgccgcgcgctacacggcaggcgcgacccggttcctgtgccccgctgag
ctcgatccagcggtagctgaggcgtgcgcgtccgtggcgttgcgggtgcacgacgtgctc
ggactgcgcgacctgtcacggaccgacctgatcgtcacccccgacggggtgccgacgttc
ctggaggtcaacgtggctcccggcatgaccgagacgtcggccgtgccgctcgccgtcgag
tctgccggctggagcctgggcaagatgtgcgccgacctgatccgggttgcggcacgtcga
ggtggacgcgtgccggcggagcccgtcgcgtga

DBGET integrated database retrieval system