KEGG   Monomorium pharaonis (pharaoh ant): 105828125Help
Entry
105828125         CDS       T05760                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00071  Fatty acid degradation
mpha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105828125
Enzymes [BR:mpha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105828125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Phage_GP20
Motif
Other DBs
NCBI-GeneID: 105828125
NCBI-ProteinID: XP_012521784
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MFALTKNGLQKSMISRGGVALTQQFARSTASSSYDTTEYQYMQMSKVPTLHFQASLPRLP
IPKLEDTCRRYLNAQKPLLSDEQLRHTSSCVSKFLASEGQGLQKLLLKSNADNSHTSYIS
EPWFDMYLQDRKPLPINYNPFLVFVPESDPKYDNQLVKATNLVVSSLRFLRSLRDNILEP
EVFHLKPEKSDTQLFRNVTKLIPSRFSWYGAYLFKAFPLDMSQYKNLFNTTRIPELGKDR
IFHNPSGRHLVVMRRGHFYAFDVLDANDSIRSPKEIAACLKAILEDDRPSNRHPVGVLTS
LERDQWARARTHLVETGNREILQKIDSAVFVMILDDETIGTEYNKLIKTYLHTDGTNRWF
DKSFSLIVSKDGYGGINFEHSWGDGVAVLRFFQDVKADISKKPRFHPNEVDELSKESANV
EKLQFSIDAKSENIIDQQKRDYQTWVNRLCVDFMINEEFGKNQCKKLGVSPDAVMQLAFQ
LAFYTLEGKSVPTYESCSTAAYKHGRTETIRPCTLETKAICVAMTQKQIELSKSELKKMI
IECSKAHNVLTKEAVMGQGFDRHLFALRKISEKSGSVKPTIFQDPAYDALNYIILSTSTL
SSPDVMVGGFGPVVSDGYGIGYMIQENRLGSVVTSYDGSRNANQYIQALVHAFKSIHDVL
IT
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccctaacgaaaaacggactccaaaagtctatgataagccgtggcggggtggca
ctaactcagcaattcgctagaagcactgcatcgtcatcgtacgacaccaccgaatatcaa
tacatgcagatgagcaaggtgccgacgttgcactttcaagcgtccctgccccgtttacca
ataccgaagctcgaggacacgtgcaggcggtatctgaatgcgcaaaagcctctgttgagc
gacgagcagctgcgacacacgtcatcttgcgtatcgaagttcctcgccagcgagggacag
ggcctacagaagctgctgctcaaaagcaacgccgataactcacataccagctacatcagc
gagccatggtttgacatgtacctacaggatcgcaagcccctaccaatcaactacaatccc
ttcttggttttcgtgccagaatccgatccgaaatatgacaatcaattggtgaaagcgacc
aatctcgtcgtgtcgtcgctgagattcctaaggtcactcagggataacattctggagcca
gaggtgttccatttgaaacctgaaaagtcggacacccagttgtttcgcaatgtcactaaa
ctgatcccatctcgctttagctggtatggcgcttatttatttaaggcttttccattggat
atgtcccagtacaagaacctgtttaacacaacgagaataccggagttaggaaaagataga
atctttcacaatccttcaggcaggcacttggtcgtaatgaggagaggtcatttttatgcg
tttgatgttctggatgcgaacgactccattcgcagtcctaaagagatagctgcgtgtttg
aaggccattttggaagacgacagaccatcgaacagacatcccgtaggtgttctcacgtca
ttggaaagggatcagtgggcacgggcgcgcacacatttggtcgaaacggggaatcgagaa
attctccaaaaaatcgactctgctgtatttgtgatgatcttggacgatgaaacaatcggt
accgagtataacaagttaattaaaacgtatttacatacggacggtaccaatcgatggttt
gacaagtcgttttccctcattgtttccaaggacggttacggcggcatcaacttcgagcat
tcatggggcgacggtgttgcggtactcagattcttccaagacgtgaaggccgacatatcg
aagaaacctagatttcatcctaacgaagtggatgaattgtctaaagagagtgcaaatgta
gagaaattacaattttctatagacgctaagagcgaaaacattatcgatcagcagaaaaga
gattatcaaacatgggtaaatcgactgtgtgtcgatttcatgattaatgaggaatttggt
aagaatcaatgcaagaagctcggggtaagtccggacgctgtaatgcagctggcattccag
ttggcattctataccctagaaggcaaatcggtaccaacttatgaatcttgcagcacagct
gcatacaaacacggtagaacagaaaccatcagaccctgtacactggagactaaagcgatt
tgcgtcgctatgactcagaagcaaatcgagctttctaaatcagaattaaagaaaatgata
attgaatgcagtaaagctcataacgtgctcacgaaagaggccgtaatgggccagggattc
gataggcatttattcgctctgagaaaaatttcagagaaatcgggttcggttaagccaacc
atttttcaagatcccgcttacgatgccttgaattacatcatattgtctacatctaccttg
tcgagtccagatgtaatggttggtggatttggaccagtagtatctgatggttatggaatt
ggatatatgatccaagaaaatcgtttgggttcagtcgtgacgagttatgatggcagtcgt
aacgccaatcaatacatacaagcgctagtacatgctttcaagagcatccatgacgtatta
atcacgtaa

DBGET integrated database retrieval system