KEGG   Monomorium pharaonis (pharaoh ant): 105830681Help
Entry
105830681         CDS       T05760                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00310  Lysine degradation
mpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105830681
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpha03036]
    105830681
Enzymes [BR:mpha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     105830681
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     105830681
Chromosome and associated proteins [BR:mpha03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105830681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-MYND TPR_12 SET
Motif
Other DBs
NCBI-GeneID: 105830681
NCBI-ProteinID: XP_012525624
LinkDB All DBs
Position
Unknown
AA seq 439 aa AA seqDB search
MSGNVLKKGTTIINDRPFVFTLSSKDRTTRCDNCLKSGKLLKCSGCQYVYYCDRNCQKES
WSIHKAECAHLKKVSPKVLPDAARLMARIILKLNQGGADEVGYYTEKNFRKFKDLMSHYS
DVKADAKRMEHFTSLCGVLFQFLNEALIPNIAELMGIYGRICTNSFNILDLNMNTIGVGI
YLGASVMDHSCKPNAVAIFEGTTIIIRTLMDLPCFDWSQIRISYVDLLSSNKDRREELHN
TYYFWCDCERCKKEEPMAEAAACPNSSCDSPCSIEVDECEKCNTRISVEFKKTFQEVVDF
TVHHLEKMKTMAYLDACKICLKKQKGIMHKFNVQHVRTLEMAHIAAMDLKCWEDAEIYGK
ELLPGYLLYYGEVHPLTGLLYLMIGKIQLHLEKPKEALQVLNQASTVLMITHGDKHSLIR
EELRPLIYQATMESDTHDV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaatgtattaaaaaaaggaacaacaatcattaatgacagaccattcgttttt
actctcagttcgaaagacaggactactcgatgtgacaattgcttgaagagtggaaaattg
ttaaaatgctcaggttgtcaatacgtatattactgtgatcgtaattgtcagaaagaatca
tggtcgatacacaaggcagaatgtgcacatttgaaaaaggtatcaccaaaagtgttgcca
gatgctgccagactcatggcacgaataattctcaaactcaatcagggtggagctgacgaa
gtaggctattatactgagaagaactttagaaaattcaaagatctaatgtctcattactca
gatgtaaaagcagatgcaaagcgaatggaacactttacttcattgtgtggagttttattc
caattcctcaatgaggcacttatacctaacattgctgagttgatgggtatttatggtagg
atatgcacgaatagcttcaacatactggatcttaatatgaatactattggagttggtatt
tatctgggagcatctgtgatggatcatagttgcaaacccaacgcagttgccatttttgaa
gggactaccatcatcatcagaacattgatggatcttccctgtttcgactggtcgcagata
agaatatcatatgtcgatttacttagttctaataaggacagacgtgaagaactgcacaat
acatattacttctggtgtgattgtgaaagatgtaaaaaagaggaaccaatggctgaagcg
gccgcgtgtccaaactcatcgtgcgattcgccgtgttcgattgaagttgacgaatgcgag
aagtgtaataccagaatatctgtagagtttaagaaaacatttcaggaagtggttgatttt
accgttcatcatttggaaaagatgaaaactatggcttatctggatgcttgtaagatatgt
ttgaagaagcagaagggcataatgcataaatttaatgtacaacatgtccgtactctcgaa
atggctcatatcgcggctatggacctgaaatgttgggaagatgcagaaatttatggcaag
gaactcttgccaggatatttattgtattacggggaagtacatcctttgacaggattgttg
tatcttatgataggaaaaatacagttgcacttggaaaaaccaaaagaagcgctccaagta
ctaaaccaagcgagtacagtgttaatgataacgcacggtgataagcactctttaataagg
gaggaattgagacctttgatttatcaagccactatggagagtgatactcacgacgtgtaa

DBGET integrated database retrieval system