KEGG   Monomorium pharaonis (pharaoh ant): 105830745
Entry
105830745         CDS       T05760                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00230  Purine metabolism
mpha01100  Metabolic pathways
mpha04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105830745
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105830745
Enzymes [BR:mpha01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105830745
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 105830745
NCBI-ProteinID: XP_012525724
LinkDB
Position
Unknown
AA seq 1002 aa
MSQRQQTNEDFYLSSGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILYGLY
MVTMPGMELPARCVSAVFIVLNFGLLVWVESGTQARNSLWSVVPCIVGQLWIVYLPAQLF
LKSVKVTPRDSLAWMLLLLYLLFATLPLKLCRCVSLAFSSVLVYFIAVIGLSSTTLEDLK
TQPVDVMILTLTLFAGACILGACCYCLAEFQQRRAFLETRQSLEVQLMIEEQSAEQERLL
LSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKI
LNELFARFDQLSERYEQMRIKILGDCYYCISGAPIERPDHAVLCVYMGLSMVEAIKYVQQ
TTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNATLSF
LNGEFEVEPAHGEDREEALQKAGLVTYFIVKALKPFKPAVTKSLASLADAESSQRIIENM
QDKMDNIREDSEEFQQRLRKKLDSRGGGTDLKGHVNWLTLRFKDPNVETAFHSVEEAFSP
LSLLGGPLVTMCAAPVWRLQPWGPFTWGGAGVVALFGIVLAGATCLGSAVRATWLRSTLA
LLMTFSLIIFLLLDMTNCVIIDDIDEPPKNTSLNWNPRCPYPSYYSYIGVLALIAISMPT
YLCYPTKACLMYFLAGAQSCINALFLGLSLDREDVASHQGSVPFPQKYSLMTTLFTIANA
LIIVSRYAEKARRMLYLRGREVIAQRERAADMKRRNGALIYNILPPHVAAYFLSHARHHD
DLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFQSII
KIKTIGSTYMAASGISEVQSPQEDGPRWTHLVTLVEFALELKKALSSINEQSFNHFVLKM
GINHGPVIAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILEPFGFGFEQ
RGLVFVKGKGQLLTHYLVSKDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgtcgcagcgacagcagacaaacgaggatttctacctgagctccggcaggccgtcgaac
ctgctgaagacgagcttcagtagcgcccgcctcgagaagctctatcgcgcctcgtcgctg
caacaacgtcgcggcggcctcacgtgcttcttgatgtcggcgatcctgtacggcctctac
atggtgacgatgccgggtatggagctgccggcgcgttgcgtcagcgccgtgttcatcgtc
ctgaacttcggcttgctggtctgggtcgagagcggcacccaagcgcgtaactcgctctgg
tcggtggtgccgtgcatagtcggacagctgtggatcgtgtacctgcccgctcagctgttc
ctcaagtccgtcaaggtcacgccgagggacagcctagcctggatgctattgctgctctac
ctgctgttcgccactctgccgcttaagctatgccgttgcgtgtccctcgcgttcagcagc
gtgctcgtgtacttcatcgccgtgattggtctctccagtacgacgctggaggaccttaag
acacaacccgttgacgttatgatcctgacgttgacgctcttcgccggcgcctgtatcttg
ggtgcctgctgctactgcctggcggagttccagcagcgccgcgcctttctggagaccagg
cagagcttggaagtccagctgatgatcgaggagcagagcgcggagcaggagcggctgttg
ctcagcgttctgccggagcacgtcgcggtcaagatgcgacaggacctcggcgcgtctctc
gacacgcagttcaagaagatctacatgtccaggcacgagaacgtgtcgatactttacgcc
gacatagtcggcttcaccgcgatctcgtcgacctacagcgccagcgagctggtcaagata
ctcaacgagcttttcgcgcgattcgatcagctcagcgaacgatacgagcaaatgcgcatt
aagatcttgggggactgctattactgcataagtggtgcgcccatcgaaaggccagaccac
gcggtcctctgcgtgtacatggggctgtccatggtggaggcgattaaatacgttcaacaa
acgacgaacagccccgtcgacatgagggtgggcattcatacgggcgcggtgctcgccggg
gtcctcgggcagaggcagtggcagttcgatgtctacagcaaggacgtcgagctggcgaac
aagatggagagcagcggtagggcagggagggtacacatctcgaatgcgacgctgagcttc
ttaaacggggaattcgaggtcgagccggcgcacggggaggatcgggaagaggcactccaa
aaagctggcctcgtcacttactttatcgtgaaagccttgaagccatttaagccagcggtg
acgaaaagcctcgcgtcgctggcggacgcggaaagctcgcagagaataatagaaaatatg
caagacaagatggacaatattcgagaggattccgaggaatttcagcaacgtctgaggaag
aaactcgacagtagaggtggtggtaccgacctgaaaggtcacgtcaactggctgaccctg
cggttcaaggatccgaacgtggagacggcgttccacagcgtcgaggaggccttctcgccc
ctgtcgctcctcggcggacccttggtaacgatgtgcgcggccccggtctggaggctgcaa
ccctggggtccattcacgtggggcggcgccggggtagtcgctctcttcggcatcgtgctg
gccggtgccacctgcctgggcagcgcggtcagggcgacgtggctcagaagcaccctcgcg
ctcctgatgacgttctcccttattatatttctgctgttagacatgactaactgcgtgatc
atcgacgacatcgacgagccgccgaagaacacctcgctaaactggaacccgcgatgtccg
tatccttcgtactattcgtacatcggcgtactcgcgctgatcgccatctcgatgccaaca
tacctctgttatccgaccaaggcgtgcctgatgtacttccttgccggcgcgcaatcctgc
atcaatgccctgtttctcggattgagcctcgatagggaagacgtggcgtcgcatcaggga
tccgtgcccttcccgcagaaatactcgctgatgaccaccttgttcactatcgcgaacgcg
ctaatcatcgtgtcgagatacgccgagaaggcgcggagaatgctgtatctacgaggacga
gaggtgatcgcgcaaagggaacgagcggcggacatgaagcgaagaaatggcgcgctgata
tacaacatcctgccgccccacgtagccgcttatttcctatcgcacgcgaggcaccacgac
gatctctacagccagagctacgccgaggtgggcgtgctgttcgccagtatgccgaacttc
gcggacttctacagcgaggagagcatcaacaatcaaggcctcgagtgcctcaggttcctg
aacgaagttatctccgacttcgacgccatcctcgatcagaagaaattccagagcatcatc
aagatcaagacgataggatcgacctacatggccgcttcgggaatatccgaggtgcaatcg
ccgcaggaagacggtcctcggtggacccacctcgtcactctcgtggaattcgccctggag
cttaagaaggccctctcaagcatcaacgagcagagctttaatcactttgttttgaaaatg
ggtattaatcatggaccggtgattgccggtgtcatcggggcgcggaagccccactatgac
atttggggcaacaccgtcaatgtcgcgtcgaggatggagagcacggggaaagtcggctgc
attcaggtcaccgacgagacacggaagatactggagccatttggtttcggcttcgagcaa
cgaggtctcgtcttcgtcaagggcaaggggcagctcttaacgcactaccttgtctccaag
gacggcgttttcctcgacctcgacagcgatctacccgttgaacctacccatccgataatc
tatcagtaa

DBGET integrated database retrieval system