KEGG   Monomorium pharaonis (pharaoh ant): 105830965Help
Entry
105830965         CDS       T05760                                 

Definition
(RefSeq) carnitine O-acetyltransferase isoform X1
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105830965
Enzymes [BR:mpha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     105830965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 105830965
NCBI-ProteinID: XP_012526192
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MSKYTISAYMYFFYRKRKLLREFIKFTMDSVKHHSFFEQYITTLNLNKCPIPKQPVPDLE
QTAERYLRSVKPLLTDDEYKNTKKIVDDFISHTSAGSQLHTKLRERYQNTDNWMKDWWLE
VVYLGYRMPVIVHSSPGIIGPPIIFQQPDDVYVYAARLIAGVCDYNEMVKNGKLKQEMTR
NDPLDMQLYAMILGTHRKPGEIVDKLLHTDEATHIIIICNNNFFKLYVVDKNGILSEGKL
VAAIKDIANRSCIQGKPIGILTGNDRDTWVKDYNLLLELGNNRNIIKDIETSLFILCLDK
DIPKDAFKEKNNASVRAIQALTGYNSCTNAGNRWHDHTVQYIVSTDGFMGMGFEHSPCEG
IPFAALQDHVLKYIAEKKNNAKNVKSKDSPRPELLKFETNDAIDYAIKIATDTVDKISND
IDMECFTFDKFGTDVIKAIKLSPDSFIQIAMQVTFYNLHRKIPAQYESAALRRFINARTE
CIRSTSIESVEFVKAMHLADCENKQQKKKLLIKAINAHKKLAEQAITGQGVDRHLFGLRM
IAKSEGMELPELYKDVGYTRSTHFNVTSSQLPFKTASFACYGPVVSDGYGCCYNPRPKDI
LFAISSFKSCSETNTRDFARILQQTLIGMRDIGSD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagtatacaataagtgcgtacatgtattttttttacagaaaaagaaagctttta
agagaatttattaaatttacaatggacagcgtaaagcaccattcattctttgaacagtat
ataactacattaaacttaaataagtgtccaattccgaaacaacctgttcctgatcttgag
caaactgcagaacgttatttaagatctgtaaagccattattgactgatgacgaatataaa
aatacgaagaagattgttgatgattttataagtcatacgagtgcaggatcacaattacac
actaaattacgtgaaagatatcaaaacactgataattggatgaaagattggtggctggaa
gttgtatacctaggatatcgtatgcccgtgatcgtgcattccagtcctggaattattggg
cctccaattattttccagcaaccagatgacgtatatgtgtacgcagcccgtctcattgct
ggagtatgtgattacaatgaaatggtcaagaatggaaaattgaaacaagaaatgactcgc
aacgacccactcgacatgcagctttatgctatgatacttggcacacacaggaaaccaggt
gaaatagttgataaactgttgcacacagatgaggcaacacacataataatcatatgcaat
aataatttctttaaactttacgttgtcgataaaaacggcattttaagcgagggtaagctt
gtggctgccataaaagatattgcaaatcgctcgtgtatccagggaaaacctataggaatt
ttaactgggaacgacagagacacttgggtgaaagactacaacttacttttagaactgggt
aacaatagaaatataataaaggatatagaaacttctttgtttatattgtgtctcgataag
gatatacctaaagatgcttttaaggaaaaaaataatgcctcggtcagagcgattcaagca
ttgacaggctataatagttgcacaaacgctggtaacagatggcacgaccataccgtgcaa
tatatagtatccactgatggttttatgggcatgggattcgaacacagtccatgcgaggga
attccttttgctgctcttcaggatcacgtattaaaatatatagcagaaaaaaaaaataac
gcaaagaatgtaaaatccaaagattccccgagaccagaacttttgaagttcgaaacaaat
gacgctatagattatgcgatcaagatagctactgatacagtagataagatttcaaacgac
atagacatggaatgttttacattcgataaattcggcacagacgtcataaaagcgattaaa
ctgagtcccgacagttttattcagatcgcgatgcaagtgacattttataatttgcataga
aagataccggctcaatacgaaagtgcggcattacgacgattcataaatgccagaactgaa
tgcatcaggtccactagcattgaatcggtcgagttcgttaaagctatgcatctcgcggat
tgcgagaacaaacagcaaaagaagaaattgttgatcaaagctataaatgctcataaaaaa
cttgccgagcaagctataactggtcaaggcgtcgatagacatttgttcggcttaaggatg
atcgcaaaaagtgaagggatggagctcccagaattatacaaagatgttggttatactaga
agtacacatttcaatgtaacatcaagtcagttgccgtttaagacagcgtcttttgcttgc
tacggaccagtagtttccgatggttatggttgctgctacaatccacgaccgaaggatatt
ctattcgctatttcgtcatttaaatcgtgcagcgagactaacacgagggactttgctcgt
attttacagcagacactgatcggcatgcgagatataggaagtgattga

DBGET integrated database retrieval system