KEGG   Monomorium pharaonis (pharaoh ant): 105831911
Entry
105831911         CDS       T05760                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpha04052]
    105831911
   00536 Glycosaminoglycan binding proteins [BR:mpha00536]
    105831911
Cytokines and growth factors [BR:mpha04052]
 Growth factors
  Growth factors (RTK binding)
   105831911
Glycosaminoglycan binding proteins [BR:mpha00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105831911
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105831911
NCBI-ProteinID: XP_012527833
LinkDB
Position
Unknown
AA seq 158 aa
MITGAAVQLDYPTIIDRIFCWLSRIPYYIRRIIKLYCRTGYHLAITPSGRIEGLTGNKES
YALLYATPVSFGVIRIQSIETKLYLAFNKKGRLYGEVNMTKDNTEWEQWSIGSYDAFRSR
KYVHYGWWIGIKKNGRPKPGPKTFWGQKTIQFSAIQED
NT seq 477 nt   +upstreamnt  +downstreamnt
atgataaccggtgcggcagtacagcttgattatccgacaattatagataggattttttgc
tggttgtcgaggatcccatattatataaggcggataatcaagctgtactgccgcaccggt
tatcatctagcaattacgccgtcaggacggatcgaaggattaaccggaaacaaggagtca
tacgctctgctttatgcgacaccggtatcttttggcgttatcagaatacaaagtatcgaa
acaaaactgtacttggcatttaacaagaaagggcggttgtacggagaggtaaatatgacc
aaggacaataccgaatgggaacaatggagcattggttcctacgacgcgtttcgatcgcgt
aaatacgtgcactacggttggtggataggaataaagaaaaatggacgaccaaagccgggg
ccgaaaacattttggggacaaaaaacgatacaattttcggctatccaagaggattaa

DBGET integrated database retrieval system