KEGG   Monomorium pharaonis (pharaoh ant): 105832896Help
Entry
105832896         CDS       T05760                                 

Definition
(RefSeq) chymotrypsin-2 isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105832896
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpha01002]
    105832896
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpha04147]
    105832896
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     105832896
Peptidases and inhibitors [BR:mpha01002]
 Serine peptidases
  Family S1: chymotrypsin family
   105832896
Exosome [BR:mpha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105832896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Peptidase_S55
Motif
Other DBs
NCBI-GeneID: 105832896
NCBI-ProteinID: XP_012529670
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MALRILCLLSFLIFSHAGVLPLFDNRIVNGEDTKLGEIPYQVSLQTEYSSFHFCGGSILN
DNYVITAAHCVDDKDANDIKVVADTIDLNKPKSQHKVTKIIVHEEYDSSNSWINDIALLK
VKIPFVISATVAYVSLLPKDYVVKANDIAVASGWGDIVENGPSTNKLQRVNILIADQESC
RSIYKKEGYNVYPTQVCAYDPSVEKGICNGDSGGPLTVNGKLIGLVSWSLGCAKIKYPAV
YTRVVSYLDWIENNAI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagaattttgtgtctcctcagctttctgatattttctcatgctggagttctt
ccactttttgataacagaatcgtaaatggtgaagatactaagttaggtgaaatcccatat
caggtatctcttcaaaccgaatattcttccttccatttctgtggtggctcaatcttgaat
gataactatgttattacggcagctcactgcgttgatgacaaagacgctaatgacataaaa
gttgttgctgatactatcgacttaaataaaccaaaatcgcagcataaagtcacaaaaatt
attgtgcacgaggaatatgactcatctaattcctggattaacgatattgctttactgaag
gtaaaaattccctttgtaatatctgccaccgttgcatacgtgtctttgctaccaaaagat
tacgtagttaaggccaacgatattgctgttgcgtcgggatggggagatatcgtggagaac
gggccgagcactaataagttacaacgagtcaatattctcatcgctgatcaagaatcctgt
aggtccatatacaagaaagaaggatataatgtctatcccacccaagtttgcgcatacgac
ccatcagttgagaaaggaatttgcaacggtgattctggtggcccgttgactgtcaatgga
aaactcattggacttgtatcctggtcactaggttgtgccaaaatcaaatatcccgccgtt
tatacacgcgttgtgtcttatctagattggattgaaaataatgcaatctaa

DBGET integrated database retrieval system