KEGG   Monomorium pharaonis (pharaoh ant): 105833376
Entry
105833376         CDS       T05760                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04013  MAPK signaling pathway - fly
mpha04214  Apoptosis - fly
mpha04215  Apoptosis - multiple species
mpha04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105833376
   04391 Hippo signaling pathway - fly
    105833376
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105833376
   04215 Apoptosis - multiple species
    105833376
SSDB
Motif
Pfam: TNFR_c6 CD225 RTX
Other DBs
NCBI-GeneID: 105833376
NCBI-ProteinID: XP_012530544
LinkDB
Position
Unknown
AA seq 352 aa
MPRESCPGLLLTLVSVFVGLCESSGAQQPAQPQAQQQPQPQSQQQHPVCKPGLEFWSGER
ASCWPCTRCAPEFTLSPCAIHKDAVCGPLSALELDWSFLSSTARKRLSRAGDDDDGVTPN
AAESLRFPEERTKERPFFVAGTVNLDREGDGSLTDKEPVSISQESKSPRERRKLIVEDNL
SWDWQTGALVLAVCACIVFFLVAGCSALVYARQWRRMKRNFEPAGLEEISARLNLMVKAE
LAELVAGAPMNPGDPETRCQYLEKLLDRKREIPVVVVATTTTTTTTTTTTTTAAAATVVA
AAVGWPEAAAGNLYIEEGRTTSTPTRSKQSQIARIQRNIETILSHKTSQGAD
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgtcccgggttgctgttgaccctggtatcggtattcgtcgggcta
tgcgagtcctccggcgcccagcagccagcacagccgcaggcacagcaacagccgcagcca
cagtcgcagcagcaacatccggtttgcaagcccgggctggagttctggtccggcgaacgc
gcctcgtgctggccgtgcacccgttgcgcccccgagttcaccttaagcccgtgcgcgatt
cacaaggacgcggtatgcggcccattgtcggcactcgagctcgattggtccttcctgtcg
tcgacggccagaaaaaggctttcgcgcgccggcgatgacgatgatggagttactccaaat
gccgcggagtccttgcggttccctgaagagaggacgaaagaacggccgttcttcgttgcg
ggaaccgtcaaccttgatcgcgagggcgacggaagcttgaccgacaaggagccggtctcc
atctcgcaggaatccaaaagtccgcgggagagaagaaaattgatcgtcgaggataattta
tcgtgggactggcagaccggcgctctagtcctcgcggtatgcgcctgcatagtattcttc
ctggtagcgggatgctcggctctcgtctacgcgagacaatggcgacgaatgaagaggaac
tttgagccggcgggtctcgaagagatatcggctagattgaacctaatggtgaaggcagag
ttggccgaattggtcgcaggggcaccgatgaatccaggtgatcccgagactagatgtcaa
tatcttgagaaacttttagaccggaaacgagagattccggtagtggtggtggcgacgaca
acgacgacgacgacgacaacaacgacgacgacgacggcggcggcagcaacagtggtggcg
gcggcggttggctggccggaggcggcggccggcaacttgtacatcgaagaggggaggacc
acgtcgacgccgacgagaagcaagcaatcgcagatcgcgcgaattcaacgtaacattgaa
actattctcagtcacaaaacaagtcagggtgccgattaa

DBGET integrated database retrieval system