KEGG   Monomorium pharaonis (pharaoh ant): 105833671Help
Entry
105833671         CDS       T05760                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00020  Citrate cycle (TCA cycle)
mpha00190  Oxidative phosphorylation
mpha01100  Metabolic pathways
mpha01200  Carbon metabolism
Module
mpha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpha_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105833671
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105833671
Enzymes [BR:mpha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105833671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like FAD_binding_3 GIDA Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 105833671
NCBI-ProteinID: XP_012531030
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MLHRSISRLIQTRGVLKFVRQSHATIRNARSFHVNVSPAEKAKCGVDENSSNYPLIDHCY
DVVIVGAGGAGLRAAFGLGKKGYRVAVITKLFPTRSHTVAAQGGINAAFAEEKKDDWLYH
MYDTVKGSDWLGDQDAIHLLTREAPRAVYELENYGCPFSRTEDGKIYQRAFGGQSLQFGK
GGQAKRTCAVADRTGHALLHTLYGQSLRYDVHYFIEYFALDLLMHGRCCKGILAWELETG
LLHRFRAHHTVVATGGAERCYFSCTAAHACTGDGMAIACRAGLPLQDMEFIQFHPTGIYG
SGILITEGSRGEGGKLVNSAGEFFMEKYAPVAKDLASRDVVSRAMTVEILEGRGVGKKKD
HIYLQLNHLPAELIRDKLPGISHLAWVFAGVDVTKQPIPVIPTVHYNMGGIPTNWRAQVL
TRENEEDRPIEGLWAAGETACASVHGANRLGANSLLEIVVFGKTIADQIDCIARPGERHG
ALSSDIGEQSICRFDATRYAKGCVPIAELRDEMQRTMQRYCGVFRTCDILQRACREMSRL
YTCDLPDLCVQDQSLIWNTELVEALELQNMMLVCMNTVYAAENRKESRGSHAREDFKDRV
DEYDYTKPLDGQKKRPYPEHWRKHTLTWAQEDGTIFISYRPVIDTTLDETEAQHVPPAVR
AY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatcggtcgatcagtcgactaatacaaacgcgtggagtattgaaattcgtgaga
caatctcacgcaacaattagaaatgcgcgaagctttcacgtaaacgttagcccagcggaa
aaggcaaagtgcggtgtggacgaaaacagcagtaactatcctctaatagaccactgctat
gacgtagttatagtaggagcaggaggcgcaggactaagggcggcctttggtcttggtaaa
aagggataccgtgtggcagtaataacaaaactattcccaactagatcacataccgtagct
gcccagggtggcataaacgccgcatttgccgaagagaagaaggacgattggctgtatcac
atgtacgatacagtgaaaggatctgactggttgggtgatcaggatgctattcatctactc
acgagggaagcacctcgagcagtctacgaacttgaaaattacggctgtccatttagtcgt
acggaagacggtaagatctatcagcgtgctttcggtggccagtcgttgcaatttggcaag
ggcggacaggctaagcgaacctgcgccgtcgccgatcgaaccggccacgcgttgcttcac
accctctacggacagagtcttcgctacgacgtgcattacttcatcgagtatttcgccctc
gatttgcttatgcacggccgatgctgcaaagggattctagcctgggaattggagactgga
cttctgcatcgattcagggctcatcacacagtggttgcaacgggtggtgccgaaagatgt
tacttctcctgcaccgcggcgcacgcctgcaccggcgacggcatggcgatcgcatgtcgg
gcaggactgccgttgcaggacatggaattcattcagtttcatccgaccggtatttacggc
agcggcatactcataaccgagggcagccggggagaaggcggcaaactcgtcaattccgca
ggggagttcttcatggagaagtacgcgcccgtggctaaggatctagcttcccgcgacgtt
gtgtcgagagctatgactgtcgaaatactcgaaggaaggggcgtcgggaagaagaaggat
cacatttatctgcaactgaatcatctgccggccgaactgatacgggataagctgcccggg
atctcgcatctcgcctgggtgttcgccggagtagatgtgacgaagcaaccgatcccggtg
attcccacggtgcattacaacatgggcggcatacccacgaattggcgtgcacaggtatta
acgcgagaaaatgaggaggacagaccgatcgaaggcctttgggcagccggcgagaccgca
tgtgcgtccgttcacggtgctaatcgcctgggcgctaatagtcttctggaaattgtggtc
ttcggcaaaaccatcgccgaccagatagattgtatcgccaggcctggcgaacgtcacggg
gcgttatcgtcagacatcggcgagcagtcgatttgtcgcttcgatgcaacccgttatgcg
aaaggctgcgttcccattgccgagctgcgggacgagatgcaacgtacgatgcagagatac
tgcggggtattcagaacttgtgatattctgcaacgggcatgcagagagatgtcccgtctc
tatacctgcgatctgccagatttatgcgtgcaagatcagtccctcatttggaacaccgag
ctcgtcgaggccttggagctgcaaaacatgatgctggtttgcatgaataccgtatacgcg
gccgaaaatcgaaaggaatctagaggctcgcacgccagggaagatttcaaggacagagtt
gacgagtatgactacacgaaaccgctcgacggacaaaagaaacgaccttatccggaacac
tggcgtaaacatacgcttacgtgggctcaggaggacggaacgattttcatctcttatcgg
cctgttatcgacacgactctagacgaaaccgaggcccagcatgtgccccctgcagttcgc
gcgtattga

DBGET integrated database retrieval system